ELF>@@H@8@@@@@@@@@@ ff( ((f(f@@DDPtd``E`EQtd/lib64/ld-linux-x86-64.so.2GNUGNU;uӏ{4j4ȥ%'  #&% "  $!t  C_{1fJ 84JHfXef;s. @0Qfllibm.so.6__gmon_start___Jv_RegisterClassesfrexpgetenvreallocmallocstrtolstdoutfclosefopenstderrfflushfprintffreelibgcc_s.so.1libc.so.6exit_IO_putc__isoc99_sscanfstrncpystdinvsprintfrewindfeoffgetsmemsetfseekclearerrcatopenfputsfwritefreadcatgetsstrchr__libc_start_mainferrorsetenvlibdl.so.2__intel_cpu_indicatorGLIBC_2.7GLIBC_2.2.5ii `ui jffffff$f f(f0f8f@fHf Pf Xf `f hf pfxfffffffffffffff f!f"f%f&HCMH5:%%<%@%:%h%2%h%*%h%"%h%%h%%h% %h%%hp%%h`%%h P%%h @%%h 0%%h %%h %%h%%h%%h%%h%%h%%h%%h%%h%%h%%hp%z%h`%r%hP%j%h@%b%h0%Z%h %R%h%J%h1I^HHPTIp@H@H@OHH%HtHÐUHSH=&uKfH&HfHHH9s$fDHH&fH&H9r{&H[fff.H=%UHtHt fÐUHHATAUAVAWSHXIy$Hc3ۉ$$$$E3E3 $@E3$HDŽ$HHDŽ$HDŽ$$$DŽ$HD$D$HDŽ$p@D$HDŽ$AGHT$OLǾ@:utW:VuHHu3u A;LǾ@:utW:VuHHu3u ALǾ@:utW:VuHHu3u LǾ@:utW:VuHHu3u ALǾ @:utW:VuHHu3uDŽ$?LǾ@:utW:VuHHu3uDŽ$LǾ@:utW:VuHHu3uDŽ$LǾ@:utW:VuHHu3uDŽ$vLǾ @:utW:VuHHu3uDŽ$3LǾ(@:utW:VuHHu3uDŽ$LǾ0@:utW:VuHHu3uDŽ$LǾ8@:utW:VuHHu3uDŽ$jLǾ<@:utW:VuHHu3uDŽ$'LǾ@@:utW:VuHHu3uDŽ$DŽ$LǾL@:utW:VuHHu3u D$LǾT@:utW:VuHHu3uDŽ$YLǾ\@:utW:VuHHu3u,%LǾd@:utW:VuHHu3ODLǾ@:utW:VuHHu3u DŽ$/L3 H $4H $HD$DŽ$Lc$$3DI$NLǾh@:utW:VuHHu3LǾl@:utW:VuHHu3u&$3DЉ$DŽ$LǾp@:utW:VuHHu3uDŽ${LǾt@:utW:VuHHu3uDŽ$8LǾx@:utW:VuHHu3uDŽ$LǾ@:utW:VuHHu3u%LǾ@:utW:VuHHu3u%qLǾ@:utW:VuHHu3uKDIH$)LǾ@:utW:VuHHu34LǾ@:utW:VuHHu3u%LǾ@:utW:VuHHu3u %qHD$HzIcHD$Y3 K|H $H $$H$Lc$DHD$I$DŽ$ID$L;oHT$H*?@I@IM>HDŽ$@$D$awEʈ$Ƅ$$u Ƅ$Ƅ$bH$H$6H$H$Hk$u$u3H$@DŽ$H|$=D$pD$xL$Ll$LH$LH$AMH^=$H$$HcH$I;|H$HT$D$pD$xHLH$3$@f$H$P$XD$`M扜$hID$p$uWH$@H%Hud@H$@3H$Ƅ$H$ LH$AH$H$,H <I+H$HH;$~$LHH$IMQ3H$H$LHH$HcH;AvIVAN A^ A~ǀH$0M|6t A7LAWAOL3@t.L$(MtA7AWAO3L HDŽ$(a%҉$8t%AAOAwHcIHI+HH;$t#A3H5%H$H$ 7n:J7a:J7T:J7:HKDCADCAS D‰$D$I{H$ tu$2AW L蹚H$(H҉$$t0H$(H$ Hz腑$Љ$$Hc$H;$ V$A3H=r%H$H$ D$$8t%AAOAwEGEAHAAL$0\A3EO H=%CLR L$H$$HcDŽ$H$ DŽ$H$(H7H$(rJt DŽ$8H$(DVADNDA~D+AD$Hc$H$ DŽ$$5$(@3H$H$H$0$q=H$0y4@H3AvEFAA~AV $CXA3{AN<@3EFAAvAVUA~AvAVANtAV b]H$0$RHߋ$裏H$0L@H3Eu $ptDH$0$p$*Ht1$hu $`tHߋ$h$`$đ@@3 $@3H$H$QH$0$;H$0SxENEAAEVEE^H3ASAVANARHAvEFAA~AV $AA3AV b0,H$0$PA~AvAVANrH$(Ht'H$(H$ HzF@3PH$0kwH$H$06@H3H$HtDKAA~3EVAE^D$ASWAQARAAvAVANEFD$0H A3Av AV!AN EF Hߋ$@@3zHS$S€$xt_sDKEAAAAAS{DAEȉ$D$3҉$$DC DǃAK HSs ցDKAAK*$*$*YY-Y D[ DكASAASADDSDуASAAAAAA*DY2A*D[AA¿ADYA*Y%EWAAAD$DCH$0$ $(D$mHx%`$!kw 2{ P(SEu $ptDH$0$p$ Ht1$hu $`tHߋ$h$`$觌$tu$uy$u$H$U4LH$H$$u$H$4Iă$$H$ H<H$H$H$H.A~"AV#3$IH$4A(AW$3$3$H$(HYYEOH~L$ HDH$A@Aw $-A/,MO L$E3E3҃wAA3AH$&3EgD$xL$H$L$L$$L$A΃HuDHD fuXbH;AAD+DA\$F|#AE3BL9E~AAG|7AEAEv(AAA]AEUIDE;rC\$A;wAA]DI+DA#H*YXZHA;L$H$L$L$D$xAAD$x$L$Ht7ELoAA#AEEEIDuAXbDHA;fNt'HcEID#fI*AD+ٹA;"E)IA*%AYXEt(A+McE)AF#,fI*BY@fXYXZHA!D$x$>3 H$ H$$DŽ$~z$$H$H$ Z/(,\T f/v((]_H$H;|$$H$/AV"AAOAʁAAAAAw EEEF#EAAѸA($$$$$%$$Hc$ 3ۃ$tUHcHHHHH$@H$H$P$X$L$T$@t$$HL$E3L$ID$xL$CZff.z($H$fff/\fw(fA~Aѧ Y$XH,ЉB$Cу~$$~2A2D,DTL-DD,TL$@tIHM;f#HH<$H$f3$$uw$~($~Hc$Hc$HH;$ t#@3H$H$ "@3H$$$H$ 3DŽ$HL$D$xL$L$ L$AZDL@HÉ$I;|L$D$xH$$$uH$H$H$H$ H$$uH$H$IH$$~ @@3$t H$H=%H$H$H$I$A3H=%H$_@L3H=%H $;H $Lc$@A3Y3(@3H5T%/랿p@3H5?%@H$@3H=$%k$u$u3H$)H$u)H$9$HX[A_A^A]A\H]þ@3H=%H$R@3H5%jSDŽ$HDŽ$ t K HH$KIW$3҃H4 ff|VD VDTVD\Vfn|VfAnDLVfAnDTVfAnD\VfDnf`fEnf`fEnf`fEnfaf`frfE`fafE`ffD`fDafD`fArfbfDafDo|V fEDLVfArfo-Wfo5_fDDTV fD\V fDfEbfnfEofAn|VfArDLV fDofDofAnDTVfAnD\V fEfEfDnf`fEfEnfEnf`fEnf`HfE`H;faf`frfE`fD`fafDaffD`fArfDafbfEfAfDoffEbfArfAofDfAfrfDfAfEfAfAffofsffք$ I;H$ H4ATAHHI;rH$ 3Aw@$8tT%AAWAO+ƃAO HcHH$ $$8t%AAWEGA+ƃt@3H52% {DŽ$2DŽ$u]ƀu[$8t%AAWAO@3H=%I*蠴@3H5b%=Ʒ%tu@x@A3H=.%ٵ@A3H=%A3H=%I$誵A3H5%ǴA3H5ٺ%贴HA3H5ƺ%衴A3H5%莴@3H5%{A3H5%hA3H5z%U(A3H5g%BhA3H5T%/A3H5A%A3H5.% `A3H5%@3H5%A3H5%г8A3H5%轳A3H5Ϲ%誳tA3H5%藳@3H5%脳 A3H5%qA3H5%^A3H5p%K@A3H5]%8A3H5J%%A3H57%@3H5$%A3H5%XH&HAUAVVADI袳DL@萳DL@~ELDo3YA^A]H&H @q} ((^߅ttYYu(HHDGGADWDMto73 p+pttYYɅu}(p^I*Y pƀYf\u(fÐHt&HH8GW WOHrHE3E3@Ht@L$$ILl$ILt$EL|$EH\$ HHl$(L3HG6Mc3C4*G\*AAAtEAD;}EuEL$$ELl$Lt$L|$H\$ Hl$(t @@3貯H8E3@@3螯AD;kL$$Ll$Lt$L|$H\$ Hl$(@3H5u%PH8HATAUAVAWSUVIAD$DkdAL$ El$ E|$Et$B\AD$ AL$AT$| At$tuޅk tp u 4v u 4{tvA3H=d%%% @3H5:%4v&򸉈D*AD+~ktA3&~A3Au<~t*A+-<AAD3AU*}+-$AD3AU*}wt%+-A}*dAD3}MA}*HALAPAHD3m})AUHp$hҀ%$X$`t3HpA]3f3fofmHffffffffHHr;%%t ;$XuL%t ;$`u8ԃ%t ;$hu$tu3HpA]øHpA]Ã=%u?4A}HHǾ}A|IL-[%Mv`%L-?%L|$X$`$h (%&%$%L$@AL$PAL$HA׾+H|$L5|H3H|$ |uϾ<AH|$3H$<H$XL$`L$h{tAHT$3H=M%||$Xt A;g$`t A;R$ht A;=L$@L$PL$H %3ɉ%%L$@IL$PIL$HMII$fHt2{I$fHt {IM$fM$fII|L$@L$PML$HH\$H,$+H|$LzH3H|$ {HÃ{Ƅ$;3|$:[D<4HHD$H,8}:uHcLtA>:LxtBD<tIHD$N48A>:uHT$HHfftfu HH\LcHT$A| u IBD$M;HAHT$3H=T%zH2IEAwyHcM+HLHf^yHHHfHftHt HuYILHftHt HuYrHD$H,8EXHl$EL$@3L$PL$HH\$H,$L$@IIIfHt1III|L$@{%HpA]ÿaxIfHǾdAD3x >xIff@d@fineundeL$@3L$PL$H.{%HpA]{%3HpA]ÐHt&AVAWSUVAAAHc$Ũ#CDD3A+AA+ADDcDDAADD3GBBF4F<(G4vEG<EG4vG<|HcHw HcH͠f$@v 3t?{||~u (A3v|t{uEt0ADH3bvHc$@CADDH37vpADDH3vTADDH3v8ADDH3uADDH3uADDH3uADDH3ujADDH3uPADDH3gu6EAE+DDHI3DuADDH3*uExAE+DDHI3u\ADDH3tPADH3t8ADDH3t ADDH3tqADH3tZADH3ttCEuADH3XtY][A_A^AuADH38tY][A_A^ÿADDH3tY][A_A^ÿADH3tADH3sEADH3sY][A_A^ÿADDH3s|ADDH3shlADDH3sQ\ADDH3hs:LADDH3Qs#<ADDH3:s A3,sY][A_A^DAAH3s~EiDރ~q-r~#HAUAVAWSUH`IE~A6AnEnu= z%DEv%D$H$PD$Xt{3f3fofmHHffffffffHHr{u%4y%t D;($y%t;y%t D;AAbfAtANuMAAAAAA A.A"A AV~3hx%ҍB]x%u@ADE3H=w%rAV#C AVfHHH`][A_A^A]Ã=x%u?4AqH^HǾ}ApHHw%H>w%Hw%HCq$H$P$X w%w%w%D$0AL$8AL$@AԾ+H<$HpH3H<$ puѾ<AH<$3H$,H$HL$PL$XotAH$3H=v%`q냋$Ht A;n$Pt A;Y$Xt A;DL$8L$@E3 v%3v%E3v%IfHtoIfHtoIIfIfII|L$8L$@+H<$HdoH3H<$ oHŃtƄ$+3<$:U</HH$L$8A<$:uHcLtA>:LxtB:uH$HHfftfu HHQLcH$A| uIB,M;HAH$3H=u%oH2IA$A)nHcM+HLHfnILHfHftHt HuNILHftHt Hu]N{H$L$8A$aL$$A$L$83L$@HHfHtHHH|p%AmHfHǾdA3m mHff@d@fineundeAVEAVvEAVeEAVTEAVCEA5AVEzAAVE^A8AAAAAAAtAXA<A AAAAAAt|AtdAtLAt4AtAAVDEAVD6AVD'AVDAVD AVDAVDAVwDAVfDAVUDAVDDAV3DAV"DAVDAVDsAVCdAVCUAVCFAVC7AVC(AVCAVC AAFPt =AtAu|m%tqt]p%p%u*xA|AAHD3H=ep%kl%#C4CAV`HXAV4CIAV#C:AAAt|AtdAtAtCAt+AAV!EAV2EAVEAVgCAVECAVVCAVD}AVxCnk%AVEPD$0L$8L$@k%QHAUAVAWSUH`IE~A6AnEnu=)o%DE;k%D$H$PD$Xt{3f3fofmHHffffffffHHrj%Tn%t D;)Dn%t;5n%t D;AAbgAtANuMAAAAAA A.A"A AV~3m%ҍB}m%u@ADE3H=m%gAV#C AVfHHDH`][A_A^A]Ã="m%u?4AgH^HǾ}AfHHl%H>l%Hl%Hbf$H$P$X l%l%l%D$0AL$8AL$@AԾ+H<$HeH3H<$ fuѾ<AH<$3H$,H$HL$PL$X etAH$3H=k%f냋$Ht A;n$Pt A;Y$Xt A;DL$8L$@E3 k%3k%E3k%IfHtdIfHtdIIfIfII|L$8L$@+H<$HdH3H<$ dHŃtƄ$+3<$:U</HH$L$8A<$:uHcLtA>:LxtB:uH$HHfftfu HHFLcH$A| uIB,M;HAH$3H=&j%dH2IA$AHcHcM+HLHf/cILHfHftHt HuCILHftHt Hu|C{H$L$8A$aL$$A$L$83L$@HHfHtHHH|e%`bHfHǾdA3b >bHff@d@fineundeAVEAVvEAVeEAVTEAVCEA4AVEyAAVE]A8AAAAAAAtAXA<A AAAAAAt|AtdAtLAt4AtAAVDDAVD5AVD&AVDAVDAVDAVDAVwDAVfDAVUDAVDDAV3DAV"DAVDAVDrAVCcAVCTAVCEAVC6AVC'AVCAVC AAFPt =AtAu|4b%tqt]e%e%u*xA|AAHD3H=e%/`a%#C4CAV_HWAV4CHAV#C9AAAt|AtdAtAtCAt+AAV!EAV2EAVEAVgCAVECAVVCAVD|AVxCm`%AVEOD$0L$8L$@`%PAH3|uAE3փڍtDAAAEv*DAD_HB fB fE;rGTD;w H fރ  f3H&SHtEGt5t0t+t&t! t=t=t=t=uW_u&tit$A3[[ÿA3[[ÃuCtA3H4ՠf[ttA3[[ÿA3[[ÐHAWSUHHA+CDCAtF|A3Z[3҅~4Ld$IL,$IտA3At1[IM;|Ld$L,$E;A3 [E3$A3A4ZIL;|@A3Z33~`Ld$L,$IŸgfffDa+֍<+uPAD3Z\A3AtxZIDD;|Ld$L,$@@3XZEtwdA3EZ3E3~TLd$gfffDa+֍<+uPAD3 ZtA3A4YIDD;|Ld$@@3YH][A_HvHAWSUHHA+CDCAtFA3Y3҅~4Ld$IL,$IտA3AtaYIM;|Ld$L,$E;A3;YE3$A3A4YIL;|A3X33~`Ld$L,$IŸgfffDa+֍<+uPAD3X\A3AtXIDD;|Ld$L,$@@3XEtwA3uX3E3~TLd$gfffDa+֍<+uPAD39XtA3A4(XIDD;|Ld$@@3 XH][A_HvHATAUAVAWSUH(HIIIiYL1YI.L,$LH3WH߾LXHLLX`Lc3I~D=^%DGt>HI;|LI.HI.XtL,$IE3H(][A_A^A]A\DRuDIuDBuDt-uAD=#^%Au0A3H5]%WmI.HL,$]EUI]Hu^%HH(][A_A^A]A\M6L3]%IvV,H|$LqWH D|$D$ADT$DD$6tuy]%DL$AHD$uE~EL3L$DL$KtUDL$L$H|$LL$DL$VDL$L$HSL$D$T$HL$MHD$A@HD$N0tlHD$L3L$It[UL$H|$LL$3VL$HL$D$T$HL$HD$L3ItTH|$LUHuqL$D$T$ʃxr [%IHHT$DHt$HHH+A|7 H+HHH=_%[%3I]HH(][A_A^A]A\L,$H3DGA@uTAua=`[%t_%WODA 4IA+Au GWHt&ATAUAVAWSUHHH3IHuSpH|$LvTHODl$D$ADT$DD$6tu~Z%HH][A_A^A]A\DL$E3AuE}EL3L$DL$JtRDL$L$H|$LL$DL$SDL$L$HDd$D$ADT$DIE3A@M,tqLJt%3L$jRL$tDH|$LL$FSL$HuD|$D$ADT$D3H][A_A^A]A\LKt83Qt۾H|$LRHuL$D$T$ʃxr X%;HEX%HHH+CT= H+HHHӉ\%HH][A_A^A]A\ÐHt&H|'ATAUUH3IICQu3]A]A\LHL#RHcй3H;D]A]A\Ht&UH0AFIѨ@4{Hn E33AADѸ3M-ELd$ 3Ll$AXbLt$L<$H\$A΃HuEIDfu D/HA;EAD+EA\$F|#AA3BL9E~AAGt7AEAEv&DeDAuHAA;rDdE;w ]HA+ʉ#H*YXZHA;Ld$ Ll$Lt$L<$H\$AXbLd$ Mt/AMaAA#־EAEMD̅u HEA;fHt(HcD]HD#fI*ED+ٹA;DeHA*YAXEt)A+McDeAF#$fI*BY@fXYXZHA-Ld$ H0]E3E~McLd$ L<$H\$D+ك~ ] DDeA H+A;}}E3DcAAA\A\AʍQL v'ADeDAuHAD;rGd?AD;wDeAHʼnى#H*BIM;3Ld$ IL<$H\$!HHt؃HiL;3AD+HMcHv$fHZYXZHH;r((ffHt&($D(LZEZfYfDYfXfDXfDZfEZEZEZfYfDYfXfDXfZfEZDED)D)lHI;rM;JfIZYXZHM;rE3D^ HnF ADFDMtsv щ35 +C ttYY҅u}( ^I*Y ƀYf\u (fZHAAD3H=R%GMKHt&AVAWVIZff.zf/(H<$\w(fA~(Ag w Y4$X^ H,=B4$Cƒ~xg~A2E7AGAGAG&AGAAAOAw3YA_A^23AWAWAWAYA_A^23E7AWAWAWYA_A^HvAUAVAWSUH@Hˉ3Hct4,LcMMIIID<$Dt$Dl$@l$3H l l $ HD$ID$D$I$L$(IHAZTff.zH$0ff/(\w(fA~AY D$0AX H,AADB$0ACA~D$0"A~A2D4DTT.TEAAAEAAD4DLTHHI;}*HH<$L\J3$ HD$LD$D$$L$(tH=tBD<DtDl@lHHtH<$HHI3H@][A_A^A]þH<$HI32D4TTT2҈TTTHvSHHWDOAщDOAG DDALD MDWAtEu t3[AA2t3[3Ot _HHE3H1A3fHfofo]foetJDJD\JfntJfAnDTJfAnD\JfntJfEnf`fEnf`f`fDnDTJfaf`frD\J fEntJfaDTJ ffEnfnD\J tJfEnfbfDofDTJ fArfE`fntJ fDfE`fDfD`fEnfA`fEnD\JHfDaI;fD`fArfE`fAnf`fDafAfD`fDnfafEfD`frfD`fD`fDafEbfAfDafEofD`fArfDafArfbfEfofDfDfrfEbfEfEofffArfAffDfDffEfA.fofsffH~L;sHBOBLOIHL;rIvE3V׃@=[L%tP%~DNA+ƒ~ HcHI=L%tNP%VNN+v t@3H5wK%REuV€uT=K%tO%~DFA׃v DAA+ƒ€u FV‰[W AAwADDOEw A҃D_ AA 3HcI01[ÐHt&AVAWSHDAD6D9D[A?A#AKA$AteEtxA tTA u G@E{A uBFgAtaAAD3H=I%uD[A_A^G@0AAAAD¸AAAADE*AAEAAE+C@D+xD9 AAD9McDсF< fG ;}uJQAD+kdD+u QAD+iD+u ACDDOEEADс}uXQEAAEA+DkdE+t2QEAAEAA+3DiE+AD3EmE{uiQDAE+DkdE+tAndQDAE+DiE+An,Am3AD+DA%}uθQDAE+DkdE+tAnBQDAE+DiE+uAnAmQDAE+DkdE+t JQEAAEA+3DiڐE+D D; EC%Hɋ$fA;}D+D3D [A_A^øQDAE+DkdE+u"QDAE+DiE+uAG I0AAAADʸAAAADEٸ*AAEAAE+CID+xE AAEHcAAD$ fFD%} AAAEuCQ+kd+uQ+i+u AD,DOEE3AA} AAAEuLQA+DkdE+t*QA+DiʐE+EEmE~EueQA+DkdE+tAnSQA+DiʐE+AnAmD+A%}uиQA+DkdE+tAn@QA+DiʐE+uAnAmQA+DkdE+t RQA+DiʐE+E' D;[=%Hϋ$fA;}D+ljA:D][A\øQA+DkdE+u QA+DiʐE+uA3CC.A3"DOD3HvH,%H(HҐf~ #%~x=sHf-f‰f~%3f/tYf%ff-53YÐD$D$r^}MD$ tEHD$YD$T$с?T$D$D$% ?D$D$ÐPRQSWVUAPAQATAUAVAWHHPXHH5 PXH;t*QH3E]MUHE]M܉UH3EEEEEEE܉E}Genuu}ineIu}ntelu3}7/Eu@uܸ@E D]ܸAEAE@A@DE AEEAADAAAADAt~ЉE؋E؃uhEܩt^% 3E]MUĸEȉ]̉MЉUԋE t!%=uE t@EEH)%0HPA_A^A]A\AYAX]^_[YZXÐH)%HHҐAWSUHAAEut(3H<$&4$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$H&HH(%HHҐH3H<$a3$$T$$@ $$t!$$@$$HHHH&HH'%H8HҐuAt\$D$@D$T$t\$D$ D$T$\$D$ D$T$DV333133433333'2H&HH&%H8HҐuAt\$D$@D$T$t\$D$ D$T$\$D$ D$T$DV333133333333'1H&HH%%H8HҐuAt\$D$@D$T$t\$D$ D$T$\$D$ D$T$DV333133233333'0H&HH$%qH8HҐu=t\$D$@D$T$t\$D$ D$T$\$D$ D$T$fH33333/33HH<$0H $3333/Ht&H#%H(HҐATSUH$AAt*3H<$|.$3D$@DDD$Du:Et$$@$$t$$ $$H$][A\$$ $$H33333033xHH<$//H $3333p-Ht&H"%HHҐAWSUHAAt(3H<$--$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$H333y33f.33(HH<$-H $30333 n,Ht&H9!%HHҐAWSUHAAt(3H<$+$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$H333)33*33HH<$,H $3333+Ht&H%AH8HҐ\$D$ D$T$\$D$@D$T$H333I336*33 HH<$+H $3333>*Ht&H %HXHҐAWSUHAAt(3H<$)$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$H33333+33 HH<$_*H $3333(Ht&H%AHHҐ\$D$ D$T$\$D$@D$T$H33333+33 HH<$)H $3 333 (Ht&H%<fHH뼐Ht&H|'AWSUHAAt(3H<$]'$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$AWSUHAAt(3H<$&$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$HAWSUHAAEut(3H<$&$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$H333i 33V ,33 HH<$&H $3 333 ^%Ht&H)%<aHbH뼐Ht&H|'\$D$ D$T$\$D$@D$T$\$D$ D$T$\$D$@D$T$HH3H<$a$$$T$$@ $$t!$$@$$HHHH333 33 ,33hHH<$%H $3p 333` #Ht&Hy%<fHH뼐Ht&H|'AWSUHAAt(3H<$"$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$AWSUHAAt(3H<$]"$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$HAWSUHAAEut(3H<$!$3ҋD$@DDDu9Et$$@$$t$$ $$H][A_$$ $$H333 33-33HH<$o"H $3333 Ht&H%<aHH뼐Ht&H|'\$D$ D$T$\$D$@D$T$\$D$ D$T$\$D$@D$T$HH3H<$ $$T$$@ $$t!$$@$$HHHH333Y33F-33HH<$ H $3333NHt&A~DEAE3DHAt4EE AAADHHt$A~DEAE3DHAtffoftfDEu"HHffoftfDEtEAAtUAtLHLHAtDHDHAtDHfDHAt fDBfDDDHHIA~A DA3EIt3A˅AAADHIt"A~A DA3EItfAof:c:rIHfAof:c:stFtMILHtEIDHtEIfDHtA fDBfDDDHHfHfoftfɅtH+HHHHfof:c:sH+HHATAUAVHPH$H$L$L$DJL.L+H$/A)x)p)h)`)X)P)H)@AAE=T%tNH=c3?%H+'%HH='%IcH8%H%H !=%IcH%HH u(DHH E~bDŽ$0H$pDŽ$40H$H$8H$@H="%HH$0Hi"%HPA^A]A\HHPA^A]A\H=oHtpHH<$ .H<$IMtIH=7H4$A$H=3H=H4$H%%A$.qH=%%HH=%%HAUAVAWSHHH$L$L$DJL.L+H$/A)x)p)h)`)X)P)H)@AAAEu'A/H=3HH[A_A^A]Ã=%tNH=3%H$%HH=$%IcH%H%H !%IcH%HH uDwHE~TDŽ$0H$pDŽ$40H$H$8H$@H=:"%HH$0RH #"%AH3H=3yHH[A_A^A]H %H53H:HH[A_A^A]H=HtlHH<$.H<$#HHtEH=H4$#H=3%H=H4$HV#%.H=G#%HrH %H3H:\H %H53H:DHH[A_A^A]H="%efffff.Hl$Ld$H-o %L%h %Ll$Lt$L|$H\$H8L)AIHIHt1@LLDAHH9rH\$Hl$Ld$Ll$ Lt$(L|$0H8ÐUHSHH %HtfDHHHuH[ÐHHdumpNCEP/NCAR ReanalysisNCEP Operations it slices, dices %s Options Decoding GRIB selection Misc -PDS-PDS10-GDS-GDS10-v-V-s-text-bin-ieee-grib-nh-h-dwdgrib-append-verf-cmc-d-p-i-H-NH-4yr-ncep_opn-ncep_rean-o--vwgrib: %s -min-ncep_ensargument: %s ???? allno GRIB file to process rbcould not open file: %s not enough memory could not open dump file ran out of data or bad file %ld:%lu:bad input from stdin ran out of memory inconsistent harmonic BDS rec %ld:%lu:date bitmap: %d undef %s=%s northsouthNorth PoleSouth Pole Gnomonic grid %ld:%lu:D=:%s:kpds=%d,%d,%d:"%s%ld:%lu:d=NAve=%dmemory problems PDS GDS %d %d %ld %d %g missing end section %2x %2x %2x %2x missing GRIB record(s) error writing %s %5d program error: GDS_prt_thin PDS_date: problem missing code %4.4d%2.2d%2.2d%2.2d-%2.2d%2.2d%2.2d%2.2d%2.2dsfccld base0C isothermcond levmax wind levtropopausenom. topsea bottomatmos collow cld botlow cld toplow cld layT=%fKtemp=%fKmid cld botmid cld topmid cld layhigh cld bothigh cld tophigh cld layocean columnhigh trop freezing lvlgrid-scale cld botgrid-scale cld topbndary-layer cld bot%.2f mbbndary-layer cld topbndary-layer cld layersoil columnbot land sfc modelsoil layer %dcloud ceilingCb baseCb top%.1fC ocean isotherm level%dC ocean isotherm level%d-%dm ocean layerocean mixed layer botocean isothermal layer botsfc-26C ocean layerocean mixed layerordered sequence of dataconvect-cld layerlowest level of wet bulb zeromax e-pot-temp lvlequilibrium lvlshallow convect-cld botshallow convect-cld topdeep convect-cld botdeep convect-cld top%d mb%d-%d mbMSL%d m above MSL%d-%d m above msl%d m above gnd%d-%d m above gndsigma=%.4fsigma %.2f-%.2fhybrid lev %dhybrid %d-%d%d cm down%d-%d cm down%dKpot-temp=%dK%d-%dK%d mb above gnd%d-%d mb above gnd%d pv units%.5f (ETA level)%.2f-%.2f (ETA levels)%d cm above gnd%.3f-%.3f (sigma)%d m below sea level%sECext=%d%s%doperationsresearchERA-15Euro clim support networkERA-40DEMETERPROVOSTELDAS%sclass=%s%sfirst guessinit analysisOI analysisControl forecast %dPerturbed forecastsPerturbed forecast %dCluster meansCluster std. dev.Forecast probabilityEnsemble meansEnsemble std. dev.ClimatologyClimatology simulationFcst seasonal mean%stype=%s%sensemble forecastsmon meanmon (co)varmon mean from dailyEC ensemble fcstsEC seasonal fcst mon means%sstream=%s%s%sVersion=%c%c%c%c%s%sSysVersion=%d%s%sAvgPeriod=%d%s%sFcstMon=%d%s%sEnsem_mem=%d%s%sVerfDate=%d%sens %d/%d/%d/%d%censemble(%d members) ensemble%ccluster(%d members) cluster%cens_perturbation=%c%d ens%c%d%chilow%s-res_ens_control ens%c0:%cmean%cmin val%cmax val%cnorm std dev%cstd dev%cdaily climate std dev%cdaily climate mean%cclimate percentile%cweight%cweighted mean no bias%cno bias%cweighted mean%cGRIBTAB%d:%d:%d:%dillegal gribtab line:%s var%dundefinedopnreanalysisprob(%s<%f)%cprob(%s>%f)%cprob(%f<%s<%f)%cmonyrdecadenormalcentury?? x3 hours x6 hours x12 hoursx15 minx30 min sec%d%s fcst:anl:start@%d%s:valid %d-%d%s:%d-%d%s ave:%d-%d%s acc:%d-%d%s diff:-%d to -%d %s ave:-%d to %d %s ave:time?:init fcst %d%s:nudge ana %d%s:rel. fcst %d%s:clim? p1=%d? %d%s?:0-%d%s product:ave@1yr:ave@%d%s:acc@%d%s:ave of fcst:%d to %d%s:acc of fcst:%d to %d%s:var@%d%s:%d-%d%s fcst acc:ave@24hr:%d-%d%s fcst acc:ave@%d%s:%d-%d%s fcst ave:ave@24hr:%d-%d%s fcst ave:ave@%d%s:%d-%d%s anl:ave@1yr:%d-%d%s fcst:ave@1yr:%d-%d%s fcst-anl:rms@1yr:%d-%d%s anl-anl_mean:rms@1yr:%d-%d%s fcst acc:ave@6hr:%d-%d%s fcst ave:ave@6hr:%d-%d%s fcst acc:ave@12hr:%d-%d%s fcst ave:ave@12hr:WE:NSNS:WEWE:SNSN:WEEW:NSNS:EWEW:SNSN:EW scan: %s winds(N/S) winds(grid) winds are N/S:winds in grid direction: PDS(1..%d)= %4d: %3.2x PDS10(1..%d)= %3d:PDS=%2.2x:PDS10= GDS(1..%d)= GDS10(1..%d)=:GDS=:GDS10=var0PRESPressure [Pa]PRMSLPressure reduced to MSL [Pa]PTENDPressure tendency [Pa/s]PVORTPot. vorticity [km^2/kg/s]ICAHTGPGeopotential [m^2/s^2]HGTGeopotential height [gpm]DISTGeometric height [m]HSTDVStd dev of height [m]TOZNETotal ozone [Dobson]TMPTemp. [K]VTMPVirtual temp. [K]POTPotential temp. [K]EPOTTMAXMax. temp. [K]TMINMin. temp. [K]DPTDew point temp. [K]DEPRDew point depression [K]LAPRLapse rate [K/m]VISVisibility [m]RDSP1Radar spectra (1) [non-dim]RDSP2Radar spectra (2) [non-dim]RDSP3Radar spectra (3) [non-dim]PLITMPATemp. anomaly [K]PRESAPressure anomaly [Pa]GPAWVSP1Wave spectra (1) [non-dim]WVSP2Wave spectra (2) [non-dim]WVSP3Wave spectra (3) [non-dim]WDIRWind direction [deg]WINDWind speed [m/s]UGRDu wind [m/s]VGRDv wind [m/s]STRMStream function [m^2/s]VPOTVelocity potential [m^2/s]MNTSFSGCVVVVELDZDTABSVAbsolute vorticity [/s]ABSDAbsolute divergence [/s]RELVRelative vorticity [/s]RELDRelative divergence [/s]VUCSHVertical u shear [/s]VVCSHVertical v shear [/s]DIRCDirection of current [deg]SPCSpeed of current [m/s]UOGRDu of current [m/s]VOGRDv of current [m/s]SPFHSpecific humidity [kg/kg]RHRelative humidity [%]MIXRHumidity mixing ratio [kg/kg]PWATPrecipitable water [kg/m^2]VAPPVapor pressure [Pa]SATDSaturation deficit [Pa]EVPEvaporation [kg/m^2]CICECloud Ice [kg/m^2]PRATEPrecipitation rate [kg/m^2/s]TSTMThunderstorm probability [%]APCPTotal precipitation [kg/m^2]NCPCPACPCPSRWEQWEASDAccum. snow [kg/m^2]SNODSnow depth [m]MIXHTMixed layer depth [m]TTHDPMTHDMain thermocline depth [m]MTHAMain thermocline anomaly [m]TCDCTotal cloud cover [%]CDCONConvective cloud cover [%]LCDCLow level cloud cover [%]MCDCMid level cloud cover [%]HCDCHigh level cloud cover [%]CWATCloud water [kg/m^2]BLISNOCConvective snow [kg/m^2]SNOLLarge scale snow [kg/m^2]WTMPWater temp. [K]LANDDSLMSFCRSurface roughness [m]ALBDOAlbedo [%]TSOILSoil temp. [K]SOILMSoil moisture content [kg/m^2]VEGVegetation [%]SALTYSalinity [kg/kg]DENDensity [kg/m^3]WATRWater runoff [kg/m^2]ICECICETKIce thickness [m]DICEDDirection of ice drift [deg]SICEDSpeed of ice drift [m/s]UICEu of ice drift [m/s]VICEv of ice drift [m/s]ICEGIce growth rate [m/s]ICEDIce divergence [/s]SNOMSnow melt [kg/m^2]HTSGWWVDIRDirection of wind waves [deg]WVHGTSig height of wind waves [m]WVPERMean period of wind waves [s]SWDIRDirection of swell waves [deg]SWELLSig height of swell waves [m]SWPERMean period of swell waves [s]DIRPWPrimary wave direction [deg]PERPWPrimary wave mean period [s]DIRSWSecondary wave direction [deg]PERSWSecondary wave mean period [s]NSWRSNLWRSNSWRTNet short wave (top) [W/m^2]NLWRTNet long wave (top) [W/m^2]LWAVRLong wave [W/m^2]SWAVRShort wave [W/m^2]GRADGlobal radiation [W/m^2]BRTMPBrightness temperature [K]LWRADSWRADLHTFLLatent heat flux [W/m^2]SHTFLSensible heat flux [W/m^2]BLYDPUFLXZonal momentum flux [N/m^2]VFLXWMIXEWind mixing energy [J]IMGDImage data []MSLSAMSLMAMSLETLFTXSurface lifted index [K]4LFTXKXK index [K]SXSweat index [K]MCONVVWSHVertical speed shear [1/s]TSLSABVF2PVMWCRAINCategorical rain [yes=1;no=0]CFRZRCICEPCSNOWCategorical snow [yes=1;no=0]SOILWPEVPRCWORKCloud work function [J/kg]U-GWDV-GWDPVPotential vorticity [m^2/s/kg]COVMZCOVTZCOVTMCLWMRCloud water [kg/kg]O3MROzone mixing ratio [kg/kg]GFLUXGround heat flux [W/m^2]CINConvective inhibition [J/kg]CAPETKECONDPCSUSFCSDSFCSULFCSDLFCFNSFCFNLFVBDSFVDDSFNBDSFNDDSFRWMRSNMRSnow mixing ratio [kg/kg]MFLXMomentum flux [N/m^2]LMHLMVMLYNONLATLatitude (-90 to +90) [deg]ELONEast longitude (0-360) [deg]ICMRIce mixing ratio [kg/kg]GRMRGraupel mixing ratio [kg/kg]GUSTSurface wind gust [m/s]LPSXLPSYHGTXx-gradient of height [m/m]HGTYy-gradient of height [m/m]TURBICNGIcing SIGMET/AIRMET [non-dim]LTNGLightning [non-dim]DRIPVPTMPVirtual pot. temp. [K]HLCYPROBProb. from ensemble [non-dim]PROBNPOPProb. of precipitation [%]CPOFPCPOZPUSTMVSTMNCIPNo. concen. ice particles []EVBSEVCWICWATIce-free water surface [%]CWDIVAFTADVAFTAD?? [??]DSWRFDLWRFUVIUltraviolet index [W/m^2]MSTAVMoisture availability [%]SFEXCMIXLYTRANSTranspiration [W/m^2]USWRFUpward short wave flux [W/m^2]ULWRFUpward long wave flux [W/m^2]CDLYRNon-convective cloud [%]CPRATTTDIATTRADTTPHYPREIXTSD1DNLGSPHPBL5WAVHCNWATSOTYPSoil type (Zobler) [0..9]VGTYPBMIXLAMIXLPEVAPPot. evaporation [kg/m^2]SNOHF5WAVAMFLUXDTRFUTRFBGRUNSSRUNStorm surface runoff [kg/m^2]SIPDO3TOTTotal ozone [kg/m^2]SNOWCSnow cover [%]SNOTSnow temp. [K]COVTWCovariance T and w [K*m/s]LRGHRCNVHRDeep convective heating [K/s]CNVMRSHAHRSHAMRVDFHRVDFUAVDFVAVDFMRSWHRSolar radiative heating [K/s]LWHRCDDrag coefficient [non-dim]FRICVFriction velocity [m/s]RIRichardson number [non-dim]var255var4var5HVARVariance of height [m^2]VISIBvar24Cloud Ice [kg/kg]var77Land-sea mask [1=land; 0=sea]RUNOFRunoff [kg/m^2]var118var119var120Image data [integer]VSSH3-hr pressure tendency [Pa/s]PV___var150var151var152MFXDVvar154USTRU wind stress [N/m^2]VSTRV wind stress [N/m^2]SGLYRNearby model level [integer]Latitude [deg]Longitude [deg]UMASMass weighted u [gm/m*K*s]VMASMass weighted v [gm/m*K*s]XPRATEcorrected precip [kg/m^2/s]STDZStd dev of Geop. hgt. [m]STDUStd dev of zonal wind [m/s]STDVSTDQStd dev of spec. hum. [gm/gm]STDTStd dev of temp. [K]CBUWCovar. u and omega [m/s*Pa/s]CBVWCovar. v and omega [m/s*Pa/s]CBUQCBVQCBTWCovar. T and omega [K*Pa/s]CBQWCBMZWCovar. v and u [m^2/s^2]CBTZWCovar. u and T [K*m/s]CBTMWCovar. v and T [K*m/s]STDRHStd dev of Rel. Hum. [%]SDTZSDTUSDTVSDTQSDTTPrecipitation index [fraction]NLSGPSDTRHPLTRSRHCLDRH-type cloud cover [%]Snow melt heat flux [W/m^2]SNOEVvar236OZONETotal column ozone [Dobson]GLCRPermanent snow points [mask]var129var133PRESNLTNGSDvar138VEGTBARETAVSFTRADTSSTORSurface water storage [kg/m^2]LSOILEWATRGround Heat Flux [W/m^2]MXSALBMaximum snow albedo [%]SOILLASNOWARAINGWRECGroundwater recharge [kg/m^2]QRECFlood plain recharge [kg/m^2]SNOWTSNFALBSnow-free albedo [%]RLYRSFLXMomentum flux N/m2 [M]ACONDAerodynamic conductance [m/s]SNOAGSnow age [s]CCONDCanopy conductance [m/s]LAISFCRHRoughness length for heat [m]SALBDvar185var186NDVILANDNNLATNELONNAPTMPApparent temperature [K]var195SBSNOvar201APCPNRSMINACPCPNvar209var215var217HGTNWILTWilting point [fraction]FLDCPField Capacity [fraction]SLTYPSurface slope type [Index]Soil type [Index]Vegetation type [Index]Potential evaporation [kg/m^2]SMREFSMDRYWVINCWCINCWVCONVSnow temperature [K]POROSSoil porosity [fraction]WCCONVWVUFLXWVVFLXWCUFLXWCVFLXRCSRCTRCQRCSOLvar128var130var131var132var134var135var136var137var139var140var141var142var143Surface water storage [Kg/m^2]NCRAINLSPAConvective inhibition [J/Kg]Groundwater recharge [Kg/m^2]Flood plain recharge [Kg/m^2]var173var174var175FLDCAPField capacity [fraction]Canopy drip [Kg/m^2]VBSALBVisible, black sky albedo [%]VWSALBVisible, white sky albedo [%]NBSALBNear IR, black sky albedo [%]NWSALBNear IR, white sky albedo [%]FRZRFreezing rain [kg/m^2]FROZRFrozen rain [kg/m^2]TSNOWTotal snow [kg/m^2]MTERHModel terrain height [m]var197VTCINVTCAPEVILvar213var214var216var218Potential evaporation [Kg/m^2]var232var233var237SBT112SBT113SBT114SBT115var245var250var251POZTOzone production from T termvar144var145var146var147var148var149var153OMGALFomega divided by densityvar155var156var157var158var159var160var161var162var163COVZZCovariance between u and uCOVMMCovariance between v and vCOVQZCovariance between q and uCOVQMCovariance between q and vCOVTVVCovariance between T and omegaCOVQVVCovariance between q and omegavar170var171var172LRGMRLarge scale moistening rateVDFOZOzone vertical diffusionPOZOzone productionAMSRE9AMSRE10AMSRE11AMSRE12var180GWDUGWDVCNVUCNVVAKHSAKMSvar187TOZOzone tendencyvar189var190SUNSDSunshine duration [s]MOSFEPSRRadiative emiissivityvar194QZ0q at top of viscous sublayerCNGWDUCNGWDVvar198var199var200THZ0CNVUMFConvective updraft mass fluxCOVPSPSQMAXQMINCOVQQCovariance between q and qvar207var208CNVDMFConvective downdraft mass fluxvar210var211var212CNVDEMFCOVVVVVvar221var222var223var224var225var226var227var228var229var230var231COVTTCovariance between T and Tvar235WTENDTendency of vertical velocityvar238POZOvar240var241var242var243var244var246var247var248var249var252var253var254AVDEPTHOcean depth - mean [m]DEPTHELEVMXEL24MNEL24Oxygen (O2 (aq)) []PO4PO4 [Mol/kg]NO3NO3 [Mol/kg]SiO4SiO4 [Mol/kg]CO2aqCO2 (aq) [Mol/kg]HCO3HCO3 - [Mol/kg]CO3CO3 -- [Mol/kg]TCO2TCO2 [Mol/kg]TALKTALK [Mol/kg]S22INV1INV2WVRGHWave Roughness[ ]WVSTRSWave Stresses []WHITEWhitecap coverage []SWDIRWIDSwell direction width []SWFREWIDSwell frequency width []WVAGEWave age []PWVAGEPhysical Wave age []var164LTURBvar166var167var168var169AIHFLXNet Air-Ice heat flux [W/m^2]AOHFLXIOHFLXIOSFLXNet Ice-Ocean salt flux kg/s]OMLTOMLSOMLPOTDENOMLUOMLVASHFLAssimilative Heat Flux [W/m^2]ASSFLBOTLDBottom Layer Depth [m]UBAROBarotropic U Velocity [m/s]VBAROBarotropic V Velocity [m/s]INTFDInterface Depth [m]WTMPCTemperature [C]SALINSalinity [psu]EMNPKENGKinetic Energy [J/kg]var191LAYTHLayer Thickness[m]SSTTSSSTOVHDOVSDOVMDvar202var203var204var205var206var219var220var234var239RERRVARSTRFStream function [m**2 s**-1]PTPotential temperature [K]EQPTSEPTSSFRSoil sand fraction [(0 - 1)]SCFRSoil clay fraction [(0 - 1)]SROSurface runoff [m]SSROSub-surface runoff [m]Wind speed [m s**-1]UDVWVDVWURTWVRTWALUVPALUVDALNIPALNIDUVCSPARCSUCTPUCLNUCDVvar25Lake cover [(0 - 1)]CVLLow vegetation cover [(0 - 1)]CVHTVLType of low vegetation []TVHType of high vegetation []CISea-ice cover [(0 - 1)]ASNSnow albedo [(0 - 1)]RSNSnow density [kg m**-3]SSTKSea surface temperature [K]ISTL1ISTL2ISTL3ISTL4SWVL1SWVL2SWVL3SWVL4SLTSoil type []ESSnow evaporation [m of water]SMLTSnowmelt [m of water]SDURSolar duration [s]DSRPMAGSS10FG10 metre wind gust [m s**-1]LSPFMX2T24MN2T24MONTMEAN2T24MN2D24UVBPARvar61OBCTObservation count []var63var64var65var66var67var68var69var70var71ISSRDISTRDSDFORCRWCCSWCETADOTTCLWTCIWvar80Experimental product []var81var82var83var84var85var86var87var88var89var90var91var92var93var94var95var96var97var98var99var100var101var102var103var104var105var106var107var108var109var110var111var112var113var114var115var116var117MX2T6MN2T610FG6EMISvar125var126ATAtmospheric tide []BVBudget values []Geopotential [m**2 s**-2]Temperature [K]UU velocity [m s**-1]V velocity [m s**-1]Specific humidity [kg kg**-1]Surface pressure [Pa]Vertical velocity [Pa s**-1]TCWTotal column water [kg m**-2]TCWVVOVorticity (relative) [s**-1]STL1Soil temperature level 1 [K]SWL1LSPCPConvective precipitation [m]SFBLDSSHFSLHFCHNKCharnock []SNRTNRTop net radiation []Mean sea level pressure [Pa]LNSPShort-wave heating rate [K]Long-wave heating rate [K]Divergence [s**-1]GHHeight [gpm]TSPBLHBoundary layer height [m]SDORISORANORSLORTotal cloud cover [(0 - 1)]10U10V2 metre temperature [K]2DSSRDSTL2Soil temperature level 2 [K]SWL2LSMLand-sea mask [(0 - 1)]SRAlbedo [(0 - 1)]STRDSSRSTRTSRTTREWSSNSSSEvaporation [m of water]STL3Soil temperature level 3 [K]SWL3CCCLCCLow cloud cover [(0 - 1)]MCCMedium cloud cover [(0 - 1)]HCCHigh cloud cover [(0 - 1)]SUNDEWOVNSOVNWOVNEOVBTMPLGWSMGWSGWDSRCVegetation fraction [(0 - 1)]VSOMX2TMN2TPAWRORunoff [m]TCO3Total column ozone [kg m**-2]10SI10 metre wind speed [m s**-1]TSRCTTRCSSRCSTRCTISRVIMDDHRDHVDDHCCDHLCVDZWVDMWEWGDNSGDCTZWCTMWVDHHTCCHTLCCRNHTPTotal precipitation [m]IEWSINSSISHFIEASQLSRHSKTSkin temperature [K]STL4Soil temperature level 4 [K]SWL4Soil wetness level 4 [m]TSNTemperature of snow layer [K]CSFLSFACFALWFALForecast albedo [(0 - 1)]FSRForecast surface roughness [m]FLSRCLWCCIWCCloud cover [(0 - 1)]AIWICEIce age [(0 - 1)]ATTEATHEATZEATMWIndicates a missing value []var6var7var8var9var10var15var16var17var18var19var20TPOvar72var73var74var75var76var78var79var124Height [m]var1var2var3var11var12var13var14var21var22var23var26var27var28var29var30var31var32var33var34var35var36var37var38var39var40var41var42var43var44var45var46var47var48var49var50var51var52var53var54var55var56var57var58var59var60var62var121var122var123var127var165var176var177var178var179var181var182var183var184var188var192var193var196TSRUTTRUTSUCTTUCCLWCloud liquid water [kg kg**-1]CFCloud fraction [(0 - 1)]ATTATHATZWATMWAXMVV2TAG22TAG12TAG02TALM12TALM2TPAG20TPAG10TPAG0STAG0MSLAG0H0DIPHSLPSAIPWHIPTALM2KTAG2KTALM8KTALM4KTAG4KTAG8K10GPCAPEPTPG1TPG5TPG10TPG20TPL01TPRL1TPRG3TPRG510SPG1010SPG1510FGG1510FGG2010FGG252TL273SWHG2SWHG4SWHG6SWHG8MWPG8MWPG10MWPG12MWPG15TPG40TPG60TPG80TPG100TPG150TPG200TPG300ZPGeopotential probability [%]TAPSFPTCCP10SP2TPMX2TPMN2TPTPPSWHPMWPP10FGISFISnowfall index [(-1 to 1)]10WSI2TIMAXSWHIMX2TIMN2TITPI2TPLM102TPLM52TPL02TPL52TPL102TPG252TPG302TPG352TPG402TPG45MN2TPLM10MN2TPLM5MN2TPL0MN2TPL5MN2TPL10MX2TPG25MX2TPG30MX2TPG35MX2TPG40MX2TPG4510SPG2010SPG3510SPG5010GPG2010GPG3510GPG5010GPG7510GPG100TPPG1TPPG5TPPG10TPPG20TPPG40TPPG60TPPG80TPPG100TPPG150TPPG200TPPG300SFPG1SFPG5SFPG10SFPG20SFPG40SFPG60SFPG80SFPG100SFPG150SFPG200SFPG300TCCPG10TCCPG20TCCPG30TCCPG40TCCPG50TCCPG60TCCPG70TCCPG80TCCPG90TCCPG99HCCPG10HCCPG20HCCPG30HCCPG40HCCPG50HCCPG60HCCPG70HCCPG80HCCPG90HCCPG99MCCPG10MCCPG20MCCPG30MCCPG40MCCPG50MCCPG60MCCPG70MCCPG80MCCPG90MCCPG99LCCPG10LCCPG20LCCPG30LCCPG40LCCPG50LCCPG60LCCPG70LCCPG80LCCPG90LCCPG99MAXSWHUSTVSTHMAXWMBModel bathymetry [m]MP1MP2WDWP1WWP2WWDWWWP1PSP2PSDWPSSWHSignificant wave height [m]MWDMean wave direction [degrees]PP1DPeak period of 1D spectra [s]MWPMean wave period [s]CDWWSHWWMDWWMPWWSHTSMDTSMPTSMean period of total swell [s]SDHSMU10MDWIMean wind direction [degrees]SDUMSQSAWHAltimeter wave height [m]ACWHARRCDWI2DSP2DFDWSKWave spectral kurtosis []BFIBenjamin-Feir index []WSPOcean salinity [psu]Ocean U velocity [m s**-1]Ocean V velocity [m s**-1]Ocean W velocity [m s**-1]Richardson number []U*V product [m s**-2]U*T product [m s**-1 deg C]V*T product [m s**-1 deg C]U*U product [m s**-2]V*V product [m s**-2]UV - U~V~ [m s**-2]UT - U~T~ [m s**-1 deg C]VT - V~T~ [m s**-1 deg C]UU - U~U~ [m s**-2]VV - V~V~ [m s**-2]Sea level [m]Barotropic stream function []Depth [m]U stress [Pa]V stress [Pa]Net surface heat flux []Surface solar radiation []P-E []Heat flux correction [W m**-2]Observed heat flux [W m**-2]In situ Temperature [deg C]OCPTOCUOCVOCWMSTVVSVDFDEPBottom level Depth [m]STHSigma-theta [kg m**-3]UVUV product [m**2 s**-2]UTUT product [m s**-1 degC]VTVT product [m s**-1 deg C]UUUU product [m**2 s**-2]VV product [m**2 s**-2]SL_1BSFMLDBTPSHSteric height [m]CRLCurl of Wind Stress [N m**-3]TAXU stress [N m**-2]TAYV stress [N m**-2]TKINSFASRPMESSTSHFDTEHFC20D20 degrees isotherm depth [m]TAV300UBA1VBA1ZTRMTRZHTMHTUMAXU velocity maximum [m s**-1]DUMAXSMAXSalinity maximum [psu]DSMAXDepth of salinity maximum [m]SAV300LDPLDUPTIPTAEBPTAPTPTBEASAnalysed salinity [psu]SALISalinity increment [psu]EBTEBSVVISUBISALESalinity analysis error [psu]BSALBackground Salinity [psu]Reserved []SALBEEBTAEBSALTILSIBZPGABMPGAEBTLEBSLFGBTFGBSBPAApplied bias in pressure [Pa]FGBPFG bias in pressure [Pa]PTAPSAPWCSoil wetness level 1 [m]Snow depth [m of water]Snowfall [kg m**-2 s**-1]Relative humidity [(0 - 1)]Soil wetness level 2 [m]Top solar radiation [W m**-2]Evaporation [kg m**-2 s**-1]Soil wetness level 3 [m]Percentage of vegetation [%]Runoff [kg m**-2 s**-1]ZZTZTTQZQTQQUZUQVZVQVUWZWTWQWUWVWWCLWCERForecast albedo []MOFLMomentum flux [N m**-2]HSDUpdraught mass flux [kg m**-2]Variance of temperature [K**2]TSWTotal soil moisture [m]Top thermal radiation [W m-2]STRFAVPOTATCLWATCIWAZATATemperature anomaly [K]UAU velocity anomaly [m s**-1]VAV velocity anomaly [m s**-1]TCWATCWVASTAL1MSLATCCA10UA10VA2TASUNDASunshine duration anomaly [s]MX2TAMN2TASolar insolation [W m**-2]TPASNOESnow melt m of water s**-1MSSSurface net radiation W m**-2Long-wave heating rate K s**-1Top solar radiation W m**-2Top thermal radiation W m-2Evaporation m of water s**-1Sunshine durationRunoff m s**-1Solar insolation W m**-2Total precipitation m s**-1SFARASUNDARARunoff anomaly [m s**-1]TPARASurface runoff [kg m**-2]Sub-surface runoff [kg m**-2]10m U wind over land [m s**-1]10m V wind over land [m s**-1]1.5m temperature over land [K]Sea-ice thickness [m]Ocean mean ice depth [m]Soil temperature layer 1 [K]1.5m temperature [K]1.5m dewpoint temperature [K]Soil temperature layer 2 [K]Fractional land mask [(0 - 1)]Soil temperature layer 3 [K]Soil temperature layer 4 [K]Large-scale precipitation [m]Total soil wetness [m]CAPField capacity [(0 - 1)]Wilting point [(0 - 1)]Roughness length [(0 - 1)]TSMAERMR01AERMR02AERMR03AERMR04AERMR05AERMR06AERMR07AERMR08AERMR09AERMR10AERMR11AERMR12AERGN01AERGN02AERGN03AERGN04AERGN05AERGN06AERGN07AERGN08AERGN09AERGN10AERGN11AERGN12AERLS01AERLS02AERLS03AERLS04AERLS05AERLS06AERLS07AERLS08AERLS09AERLS10AERLS11AERLS12AERPRAERSMAERLGAODPRAODSMAODLGAERDEPAERLTSAERSCCSoil clay content [%]CO2Carbon Dioxide [kg kg**-1]CH4Methane [kg kg**-1]N2ONitrous oxide [kg kg**-1]TCCO2TCCH4TCN2OCO2OFCO2NBFCO2APFCH4FkCH4CO2FIRECOFIRECH4FIRENMHCFIREH2FIRENOXFIREN2OFIREPM2P5FIRETPMFIRETCFIREOCFIREBCFIRECFIREC4FFIREVEGFIRECCFIREFLFIREWildfire Fuel LoadBFFIREOAFIREWildfire observed area [m**2]FRPFIRECRFIRENO2Nitrogen dioxide [kg kg**-1]SO2Sulphur dioxide [kg kg**-1]COCarbon monoxide [kg kg**-1]HCHOFormaldehyde [kg kg**-1]TCNO2TCSO2TCCOTCHCHONOXNitrogen Oxides [kg kg**-1]TCNOXGRG1TCGRG1GRG2TCGRG2GRG3TCGRG3GRG4TCGRG4GRG5TCGRG5GRG6TCGRG6GRG7TCGRG7GRG8TCGRG8GRG9TCGRG9GRG10TCGRG10SFNOXSFNO2SFSO2SFCO2SFHCHOSFGO3SFGR1SFGR2SFGR3SFGR4SFGR5SFGR6SFGR7SFGR8SFGR9SFGR10RaRadon [kg kg**-1]SF6TCRaTotal column Radon [kg m**-2]TCSF6SF6APFGO3GEMS Ozone [kg kg**-1]GTCO3AOD550SSAOD550DUAOD550OMAOD550BCAOD550SUAOD550AOD469AOD670AOD865AOD1240OROGOrography [m]ZUSTFriction velocity [m s**-1]MEAN2TMEAN10WSMEANTCCDLLake depth [m]LMLTLake mix-layer temperature [K]LMLDLake mix-layer depth [m]LBLTLake bottom temperature [K]LTLTLSHFLICTLake ice temperature [K]LICDLake ice depth [m]DNDZNDNDZADCTBDuct base height [m]TPLBTrapping layer base height [m]TPLTTrapping layer top height [m]SMSoil Moisture [kg m**-3]U10NV10NVTNOWDUTNOWDSTSoil Temperature [K]Total Cloud Cover [%]Field capacity [kg m**-3]Wilting point [kg m**-3]Total Precipitation [kg m**-2]PAOTPAOPCWRFRAINFICEFRIMERime factor []CUEFIConvective cloud efficiency []TCONDTotal condensate [kg/kg]TCOLWTCOLITCOLRTotal column rain [kg/m/m]TCOLSTotal column snow [kg/m/m]TCOLCPLPLHLPLCEMSCloud Emissivity [fraction]COPDCloud Optical Depth [non-dim]PSIZTCWATTotal Water Cloud [%]TCICETotal Ice Cloud [%]WDIFWind Difference [m/s]WSTPWave Steepness [non-dim]PTANPTNNPTBNPPANPPNNPPBNPMTCPMTFAETMPAEDPTAESPHAEUWDAnalysis Error of U-wind [m/s]AEVWDAnalysis Error of V-wind [m/s]LPMTFLIPMFREFZRREFZIREFZCTCLSWTCOLMELRDIEllrod Index [non-dim]TSECTSECANUMAEPRSICSEVIcing Severity [non-dim]ICPRBIcing Probability [non-dim]LAVNIHAVNIFLGHTFlight Category [non-dim]OZCONOzone concentration [ppb]OZCATVEDHSIGVSigma level value [non-dim]EWGTEnsemble Weight [non-dim]CICELCIVISCIFLTLAVVLOVVUSCTVSCTLAUVLOUVTCHPDBSSODHAOHCOcean Heat Content [J/m^2]SSHGSLTFLSalt flux [g/cm^2/s]DUVBCDUVBTHFLXUVARU velocity variance [m^2/s^2]VVARV velocity variance [m^2/s^2]UVVCCMCLSLAPPLOPPREFOREFDREFCSBT122SBT123SBT124SBT125MINRHMAXRHCEILCeiling [m]PBLREGSBC123SBC124RPRATESPRATEFPRATEIPRATEUPHLUpdraft Helicity [m^2/s^2]SURGEStorm Surge [m]ETSRGExtra-tropical storm Surge [m]RHPWOZMAX1OZMAX8PDMAX1PDMAX24MAXREFMXUPHLMAXUVVMAXDVVMAXVIGRETOPRadar echo top (18.3 dbZ) [m]VRATEVentilation rate [m^2/s]TCSRG20TCSRG30TCSRG40TCSRG50TCSRG60TCSRG70TCSRG80TCSRG90HINDEXHaines index []DIFTENPSPCPPseudo-precipitation [kg/m^2]MAXUWMAXVWMEIPMean icing potential []MAIPMaximum icing potential []MECTPMACTPMECATMACATCBHEPCBBPCBTPECBBPECBTHCBBHCBTHECBBHECBTEXTNCAODAerosol Optical Depth [-]ASFTRAerosol Asymmetry Factor [-]SSALBDBSCTRSNOyNONitrogen Oxide [ppbV]Nitrogen Dioxide [ppbV]N2O5Nitrogen Pentoxide [ppbV]HNO3Nitric Acid [ppbV]Nitrogen Trioxide [ppbV]PNAPeroxynitric Acid [ppbV]HONONitrous Acid [ppbV]Carbon Monoxide [ppbV]NH3Ammonia [ppbV]HCLHydrogen Chloride [ppbV]ETHEEthene [ppbV]OLETOLToluene [ppbV]XYLXylene [ppbV]ISOPIsoprene [ppbV]FORMFormaldehyde [ppbV]ALD2MGLYMethyl Glyoxal [ppbV]CRESPANPeroxyacyl Nitrate [ppbV]NTRROOHEsters [ppbV]ETHOHEthanol [ppbV]METHOHMethanol [ppbV]H2O2Hydrogen Peroxide [ppbV]Hydroxyl Radical [ppbV]HO2Hydroperoxyl Radical [ppbV]ASO4ANH4ANO3AORGAAORGPAAORGBAECA25AH2OANAACLASO4KANAKACLKASEASASOILACORSNUMATKNNUMACCNUMCORSRFATKNSRFACCSulfur Dioxide [ppbV]MSAMethanesulfonic Acid [Kg/Kg]TSO4DMSDimethylsulfide [Kg/Kg]DU1DU2DU3DU4DU5SS1SS2SS3SS4OCDRYOCWETBCDRYBCWETTMPFTEMPERATURE (Fahrenheit) [F]MAXKMAXFNMAXKNMAXFDMAXKDMAXFMINKMINFNMINKNMINFDMINKDMINFDWPFDPDFHTINFHEAT INDEX (deg F) [F]WNCHFWIND CHILL (deg F) [F]PQPF2PROB OF QPF >= 0.10 INCHES [%]PQPF3PROB OF QPF >= 0.25 INCHES [%]PQPF4PROB OF QPF >= 0.50 INCHES [%]PQPF5PROB OF QPF >= 1.00 INCHES [%]PQPF6PROB OF QPF >= 2.00 INCHES [%]PQPF7BQPFBEST CATEGORY OF QPF [num]NPOPDPOPPCPMPCPICPCPMCPCPIPSNA1PSNA2PSNA3PSNA4PSNA5BSNASNWMSNWIMWSPKIWSPMSKNTPWSP1PWSP2PWSP3PWSP4WSPDCXSPDMXSPDKPWDRNPWDRNEPWDREPWDRSEPWDRSPWDRSWPWDRWPWDRNWWDIRCPSKCLPROB OF TOTAL SKYPSKFWPSKSCPSKBKPSKOVSKYCMSKCLPROB MEAN SKY CVRMSKOVMSKMCMSKPCMSKMOMSKYCPCIG1PROB OF CIG HGT < 200 FT [%]PCIG2PROB OF CIG HGT 200-400 FT [%]PCIG3PROB OF CIG HGT 500-900 FT [%]PCIG4PCIG5PCIG6PCIG7PROB OF CIG HGT > 12000 FT [%]BCIGPVIS1PROB OF VIS <=1/4 MILE [%]PVIS2PROB OF VIS <=1/2 MILE [%]PVIS3PROB OF VIS <=7/8 MILE [%]PVIS4PROB OF VIS <=2 3/4 MILES [%]PVIS5PROB OF VIS <=5 MILES [%]PVIS6PROB OF VIS <=6 MILES [%]VISCCATEGORICAL VISIBILITY [num]POBVNPROB OF OBSTRUCTION TO VISPOBVHPOBVMPOBVFPOVBLPROB OF BLOWING OBVIS [%]OBVCBEST CATEGORY OF OBVIS [num]NTSMCSVRUSVRUNCOND PROB OF SEVERE WX [%]NSVRNORMAL PROB OF SEVERE WX [%]UHAIUNCONDITIONAL PROB OF HAIL [%]UTORUTSWCFZIUFZICZNIUZNICLQIULQIPTYPICOND PROB OF FRZING PRECIP [%]UPOZPCPOSCOND PROB OF SNOW (CPoS) [%]UPOSUNCOND PROB OF SNOW (CPoS) [%]CPORSUPORSCPORACOND PROB OF RAIN [%]BPCPTPOPOHPOPOPCPDRZCOND PROB OF DRIZZLE [%]CPSTYCPSHWCOND PROB OF SHOWERS [%]BPCHRSUNSHHRSUNHOURS OF SUNSHINE [hrs]SCQPSCTSPSPMSLpressure reduced to MSL [Pa]DPSDTpressure tendency [Pa/s]FIgeopotential [(m**2)/(s**2)]geopot hgeopotential height [gpm]HHgeometrical height [m]dev of hTO3total ozone [Dobson Units]virt.temp.virtual temperature [K]pot. temp.potential temperature [K]pseudo-potmaximum temperature [K]minimum temperature [K]TDdew-point temperature [K]dew-pnt delapse ratelaps rate [K/m]visibilityvisibility [m]radar sp 1radar spectra (1) [non-dim]radar sp 2radar spectra (2) [non-dim]radar sp 3radar spectra (3) [non-dim]pli to 500temp anomtemperature anomaly [K]pres anompressure anomaly [Pa]geop anomwave sp 1wave spaectra(1) [non-dim]wave sp 2wave spaectra(2) [non-dim]wave sp 3wave spaectra(3) [non-dim]DDwind direction [degree true]stream funstream function [(m**2)/s]vel potentvelocity potential [(m**2)/s]M.stream fsigma vertOMEGAvertical velocity [Pa/s]vertical velocity [m/s]abs vorticabsolute vorticity [1/s]abs divergabsolute divergence [1/s]rel vorticrelative vorticity [1/s]rel divergrelative divergence [1/s]vert.u-shrvert.v-shrdir of curspd of curspeed of current [m/s]currcomp Uu-component of current [m/s]currcomp Vv-component of current [m/s]QVspecific humidity [kg/kg]RELHUMrelative humidity [%]hum mixrathumidity mixing ratio [kg/kg]TQVvapor presvapor pressure [Pa]sat.defic.saturation deficit [Pa]AEVAP_Sevaporation [kg/(m**2)]TQIprec. ratethunderst.thunderstorm probability [%]TOT_PRECPREC_GSPPREC_CONsnowf.rateW_SNOWH_SNOWsnow depth [m]mix lay demixed layer depth [m]tr therm dma therm dmain thermocline depth [m]m therm daCLCTtotal cloud cover [%]CLC_CONconvective cloud cover [%]CLCLlow cloud cover [%]CLCMmedium cloud cover [%]CLCHhigh cloud cover [%]TQCbli to 500SNOW_CONconvective snow [kg/(m**2)]SNOW_GSPlarge scale snow [kg/(m**2)]water tempwater temperature [K]FR_LANDland cover (1=land, 0=sea) [1]dev sea-leZ0surface roughness [m]ALB_RADalbedo [%]T_soilsoil temperature [K]W_soilPLCOVvegetation (plant cover) [%]salinitysalinity [kg/kg]densitydensity [kg/(m**3)]RUNOFFwater run-off [kg/(m**2)]FR_ICEH_ICEdir ice drsp ice drspeed of ice drift [m/s]ice dr uu-component of ice drift [m/s]ice dr vv-component of ice drift [m/s]ice growthice growth rate [m/s]ice divergice divergence [1/s]snow meltsnow melt [kg/(m**2)]winwav/swedir of wavhei of wavMP of wiwamean period of wind waves [s]dir of swehei of sweMP of swelmean period of swell [s]pr wave dipr wave peprimary wave period [s]se wave dise wave pesecondary wave period [s]ASOB_SATHB_SASOB_TATHB_Tl-w rad.long-wave radiation [W/(m**2)]s-w rad.global radglobal radiation [W/(m**2)]ALHFL_Slatent heat flux [W/(m**2)]ASHFL_Ssensible heat flux [W/(m**2)]bound l diAUMFL_SAVMFL_Swind mix ewind mixing energy [J]image dataimage data []temperaturtemperature (ECMF) [K]wind compUwind compVsoil temp.soil temperature (ECMF) [K]ls precip.conv prec.snowfallpressurerel. humidrelative humidity (ECMF) [%]cloud cov.total cloud cover (ECMF) [%]10m-wind U10m-wind V2m temper2m temperature (ECMF) [K]2m due-p.total prectotal precipitation (ECMF) [m]seaway 01seaway 01 (ECMF) []seaway 02seaway 02 (ECMF) []seaway 03seaway 03 (ECMF) []seaway 04seaway 04 (ECMF) []seaway 05seaway 05 (ECMF) []seaway 06seaway 06 (ECMF) []seaway 07seaway 07 (ECMF) []seaway 08seaway 08 (ECMF) []seaway 09seaway 09 (ECMF) []seaway 10seaway 10 (ECMF) []seaway 11seaway 11 (ECMF) []dw sw fluxuw sw fluxdw lw fluxuw lw fluxAPAB_Snet s fluxnet shortwave flux [W/m**2]net l fluxnet longwave flux [W/m**2]net fluxdw sw clfruw sw cldydw lw clfruw lw cldySOHR_RADTHHR_RADrad heatsoilheat Ssoilheat LCLCclc gr scQCclw gs viQIcli gs viQRQSsrc gs vissc gs viQGTWATERTDIV_HUMCH_CM_CLcl cov. CHcloud cover CH (0..8) [1]cl cov. CMcloud cover CM (0..8) [1]cl cov. CLcloud cover CL (0..8) [1]total cloud cover (0..8) [1]fogfog (0..8) [1]fog [1]clc con ciCLW_CONclw con vicli concli con vimass fl coupd vel coentr p coHBAS_CONHTOP_CONcon layersKO-indexKO-index [1]BAS_CONconvection base index [1]TOP_CONDT_CONDQV_CONH ten coQDW ten coDU_CONDV_CONvor ten codiv ten coHTOP_DCtop ind dcdry convection top index [1]HZEROCLSNOWLMTQRS_GSPPRR_GSPPRS_GSPRAIN_GSPcondens gsautocon gsaccret gsnucleat gsriming gsdeposit gsmelting gsevapor gsPRR_CONPRS_CONRAIN_CONcondens coautocon coaccret conucleat coriming cosublim comelting coevapor corain amsnow amDT_GSPDQV_GSPH ten gsDQC_GSPsnowfall (dimensionFRESHSNWfresh snow factor [1]DQI_GSPPRG_GSPGRAU_GSPRHO_SNOWsnow density [kg/m**3PPKEhdi coeffdissp ratedissipation rate [W/(Pa*m**2)]TKVMTKVHvdi coe cwvdi coe civdi coe vpdis len mdis len hvar u momvar v momvar w momvar tempvariance of temperature [K**2]var cl watvar cl icevar vap mrc wat fluxc ice fluxw vap fluxTCMdrag coefficient CD [1]TCHtr coef CQPBL-top hPBL-top h [m]T-jump hq-jump hentr at hmass fl hcl cov PBLcl wat PBLcl top PBLcloud top of PBL-clouds [m]cl bas PBLcloud base of PBL-clouds [m]moun wav Xmoun wav Ywave Riwave Richardson number [1]wav div Xwav div YVMAX_10Mmaximum wind velocity [m/s]wav dis viwv en fluxT_SOtemperature of soil layers [K]W_SOW_SO_ICEW_Iinterc icesnow fractsnow fraction [1]T_SNOWsnow temperature [K]foliag temfoliage temperature [K]infiltratinfiltration [m/s]runoffrunoff [m/s]soil evapbare soil evaporation [m/s]plant tranplant transpiration [m/s]inter evapwater evapaero resisaerodynamic resistance [s/m]plant resplant resistance [s/m]soil ressoil resistance [s/m]total evapT_ICEtemperature of sea ice [K]max wind mXYZS1 [1]RHS_SIS2 [1]DTTDIVS3 [1]SOTR_RADGEN_TEN1averaged tendencies [x/s]GEN_TEN2S7S7 [1]S8S8 [1]S9S9 [1]S10 [1]MFLX_CONCAPE_CONQCVG_CONTKE_CONMOS pTS fqMOS TS covS17S17 [1]S18S18 [1]S19S19 [1]S20S20 [1]MOS TSISO1MOS TSISO2MOS TSISO3MOS TS DENMOS TS OCCMOS TS FRQSeeg_peakjonswap parameter fm [s**(-1)]Seeg_alphajonswap parameter alpha [1]Seeg_gammajonswap parameter gamma [1]Seeg_dirSeeg_energSeeg_icemkSeegang ice mask [1]peak p swpeak period of swell [s]peak p wwpeak period of wind waves [s]Var. Geop.Var. TVarianz Temperatur [K**2]Var. uVarianz Zonalwind [(m/s)**2]Var. vVar. qMer. ImptrMer. TrEptMer. TrsWMer. TrlWVer. TrEptVer. TrsWVer.TrlWVarAF GeopVarAF uVarAF vDU_SSODV_SSOSSO_STDHSSO_GAMMAanisotropy of topography [1]SSO_THETASSO_SIGMAoro varianE-W oro vaN-S oro vaNW-SE o vaNE-SW o vainl w fracfraction of inland water [1]EMISS_RADsurface emissivity [1]SOILTYPsoil texture [1]soil colorsoil color [1]soil drainsoil drainage [1]ground watground water table [m]leaf area index [1]ROOTDProot depth [m]root densroot density [1]HMO3VIO3ld-sea mskland-sea mask [1]PLCOV_MXPLCOV_MNLAI_MXLAI_MNOrographier length mroughness length momentum [m]r length hroughness length heat [m]var smcFOR_EFOR_DNDVI_MAXNDVIRATIOAER_SEAAER_LANAER_URBAER_DEStidal tendtidal tendencies [(m/s)**2]diab heatgadiab heattotal adiabatic heating [K/s]adv q tendnadv q tenadv m te Xadv m te Ynad m te Xnad m te Ytorquebudget valbudget values [1]scale factscale factor [1]FCCoriolis parameter [s**(-1)]RLATlatitude [degr N]RLONlongitude [degr E]relax factclimsstintpot vorticln pslog surface pressure [1]ZTDZWDZHDSO2-concSO2-drydSO2-wetdSO4-concSO4-drydSO4-wetdNO-concNO-drydNO-wetdNO2-concNO2-drydNO2-wetdNO3-concNO3-drydNO3-wetdHNO3-concHNO3-drydHNO3-wetdNH3-concNH3-drydNH3-wetdNH4-concNH4-drydNH4-wetdO3-concPAN-concPAN-drydOH-concO3-drydO3-wetdO3-mixing ratio [kg/kg]I131-concI131-concentration [Bq/m**3]I131-drydI131-dry deposition [Bq/m**2]I131-wetdI131-wet deposition [Bq/m**2]Cs137-concCs137-concentration [Bq/m**3]Cs137-drydCs1370dry deposition [Bq/m**2]Cs137-wetdCs137-wet deposition [Bq/m**2]Te132-concTe132-concentration [Bq/m**3]Te132-drydTe132-dry deposition [Bq/m**2]Te132-wetdTe132-wet deposition [Bq/m**2]Zr95-concZr95-concentration [Bq/m**3]Zr95-drydZr95-dry deposition [Bq/m**2]Zr95-wetdZr95-wet deposition [Bq/m**2]USTR_SSOVSTR_SSOVDIS_SSOUV_Ind_F_hBasicUV_IFUV_Ind_W_hUV_IndmaxFSB-IndexSB-Index WKan.UVB-WIgesamt O3UV_IndmaxWh UV_IndMxpressure [hPa]geopotential height [10 * gpm]temperature [1*degree Celsius]dew-pnt tewindcompXYgeomet hgeometrical height [kft]geometrical height [hft]wind di/sp3 h pr chaSchnee-MgeSchneemenge [mm]Bod-Wass-GBodenwassergehalt [mm]stab. ind.stability index [K]max windmaximum wind velocity [km/h]maximum wind velocity [kt]wave di/heswe. di/hewave m d/hwind speedwind speed [kt]wind compXwind compYabs voradvvert. vel.vertical velocity [hPa/h]max. temp.min. temp.sul_probclopmvafeeled tsea temperGlobalstr.Nied-GW-GENiedGW-ArtNiedGE-ArtNiedBewArtKonv.U-Gr.Nied.-ArtKonv.-ArtKonv.UG-nngeostr Vorgeostrophische Vorticity [1/s]Geo VorAdvVerGraVoAdGeo TemAdvLap TemAdvOmega ForcSchichtd.AAdGeVoThWiWind-Div.Winddivergenz [1/s]QxQyDiv QDivergenz Q [m/(kg*s)]FrontoGeQnQs (geo)DivQn(geo)DivQs(geo)Fronto GenFrontoGenPFrontogenese-Parameter [1]Qs-VektorDiv QsDivergenz Qs [m/(kg*s)]IPVWind KompXWind KompYDruck-Ise.KO-IndexKO-Index [K]TT-IndexTotals-Totals-Index [K]S-IndexS-Index [K]Stein-IndSteinbeck-Index [1]Baily-IndBaily-Index [1]MicroburstMicroburst-Index [1]Cat-IndexLab-EnergLabilit{tsenergie [J/g]Virt TVirtuelle Temperatur [K]Pseudo TPseudo-Temperatur [K]Pseudo PotAequi TAequivalent-Temperatur [K]Aequi PotBas St WolBas Cu WolTop St WolTop Cu WolBas Tur WoTop Tur WoBas Eis WoTop Eis WoInt Tur WoInt Eis WoSichtweiteSichtweite [m]PIP_degreePrognostic IcingPIP_scenarProg IcingDIP_degreeDiagnostic IcingDIP_scenarDiag IcingIcingGuessIcingGradeIcingRegimGru WetterWetter - Grundzustand (wwLok WetterCLDEPTHcloud depth (grey scaleCLCT_MODcurr weathcurrent weather (symbol numberCuCumulus (0..1) [1]CbCumulimbus (0..1) [1]ScStratocumulus (0..1) [1]AcAltocumulus (0..1) [1]CiCirrus (0..1) [1]StStratus (0..1) [1]AsAltostratus (0..1) [1]BedeckungBedeckung in Stufen [1]KonvektionKonvektion ja/nein [1]MN >90%RF700 >89%RR12 zentrRR12 <=0.5RR12 SA>60RR12 Kv>60SRR12ffRRMAX/STDRRMAX/MINSN12ff >15RRgefr12ffFFboeBoeenstaerke in Stufen [1]GewitterGewitter in Stufen [1]Tx2m12h zeTn2m12h zeSCHWUELINDSchwuele-Index [1]SMOGSTUFENSmog-Intensitaetsstufen [1]SMOGHOEHEp RMS fg-ap RMS ia-au RMS fg-au RMS ia-av RMS fg-av RMS ia-afi E fg-afi E ia-arh E fg-arh E ia-at RMS fg-at RMS ia-aom E fg-aom E ia-aE fg-a KEE ig-a KERR20RR50RR100FF10FF15FF20SYNME5SYNME6SYNME7SYNMSGMSG mit Instrument SEVIRI [1]Pressure [hPa]psnmPressure reduced to MSL [hPa]tspsgeopGeopotential [dam]zgeogzgeABSOLUTE TEMPERATURE [K]vtmpVIRTUAL TEMPERATURE [K]ptmpPOTENTIAL TEMPERATURE [K]psatmxtpMAXIMUM TEMPERATURE [K]mntpMINIMUM TEMPERATURE [K]tporDEW POINT TEMPERATURE [K]dptdDEW POINT DEPRESSION [K]lpsrLAPSE RATE [K/m]rds1RADAR SPECTRA(1) [non-dim]rds2RADAR SPECTRA(2) [non-dim]rds3RADAR SPECTRA(3) [non-dim]tpanTEMPERATURE ANOMALY [K]psanPRESSURE ANOMALY [Pa hPa]zganGEOPOT HEIGHT ANOMALY [m]wvs1WAVE SPECTRA(1) [non-dim]wvs2WAVE SPECTRA(2) [non-dim]wvs3WAVE SPECTRA(3) [non-dim]WIND DIRECTION [deg]winsWIND SPEED [m/s]uvelvvelMERIDIONAL WIND (V) [m/s]fcorSTREAM FUNCTION [m2/s]potvVELOCITY POTENTIAL [m2/s]sgvvSIGMA COORD VERT VEL [sec/sec]omegOMEGA [Pa/s]omg2VERTICAL VELOCITY [m/s]abvoabdvvortVORTICITY [1/s]divgDIVERGENCE [1/s]vucsVERTICAL U-COMP SHEAR [1/sec]vvcsVERT V-COMP SHEAR [1/sec]dircDIRECTION OF CURRENT [deg]spdcSPEED OF CURRENT [m/s]ucpcU-COMPONENT OF CURRENT [m/s]vcpcV-COMPONENT OF CURRENT [m/s]umesSPECIFIC HUMIDITY [kg/kg]umrlRELATIVE HUMIDITY [no Dim]hmxrHUMIDITY MIXING RATIO [kg/kg]agplvappVAPOUR PRESSURE [Pa hpa]sadfevapEVAPORATION [Kg/m2/day]prcrthpbTHUNDER PROBABILITY [%]precprgeprcvneveSNOWFALL [Kg/m2/day]wenvnvdeSNOW DEPTH [cm]mxldMIXED LAYER DEPTH [m cm]tthdTRANS THERMOCLINE DEPTH [m cm]mthdMAIN THERMOCLINE DEPTH [m cm]mthaMAIN THERMOCLINE ANOM [m cm]cbnvcvnvCONVECTIVE CLOUD COVER [0-1]lwnvLOW CLOUD COVER [0-1]mdnvhinvHIGH CLOUD COVER [0-1]wtnvCLOUD WATER [kg/m2]blilsmkLAND SEA MASK [0,1]dslmDEV SEA_LEV FROM MEAN [m]zorlROUGHNESS LENGTH [m]albeALBEDO [%]dstpDEEP SOIL TEMPERATURE [K]soicSOIL MOISTURE CONTENT [Kg/m2]vegeVEGETATION [%]densDENSITY [kg/m3]UndefinedicecICE CONCENTRATION [fraction]icetICE THICKNESS [m]icedDIRECTION OF ICE DRIFT [deg]icesiceuU-COMP OF ICE DRIFT [m/s]icevV-COMP OF ICE DRIFT [m/s]icegICE GROWTH [m]icdvICE DIVERGENCE [sec/sec]shcwSIG HGT COM WAVE/SWELL [m]wwdiDIRECTION OF WIND WAVE [deg]wwshSIG HGHT OF WIND WAVES [m]wwmpMEAN PERIOD WIND WAVES [sec]swdiDIRECTION OF SWELL WAVE [deg]swshSIG HEIGHT SWELL WAVES [m]swmpMEAN PERIOD SWELL WAVES [sec]prwdPRIMARY WAVE DIRECTION [deg]prmpPRIM WAVE MEAN PERIOD [s]SECOND WAVE DIRECTION [deg]SECOND WAVE MEAN PERIOD [s]ocassldsNET LONG WAVE AT BOTTOM [W/m2]nswrNET SHORT-WAV RAD(TOP) [W/m2]rolelwrdLONG-WAV RAD [W/m2]sweaglbrGLOBAL RADIATION [W/m2 ]clsfcssfbldsBOUND LAYER DISSIPATION [W/m2]imagIMAGE [image^data]tp2m2 METRE TEMPERATURE [K]dp2mu10mv10mtopoTOPOGRAPHY [m]gsfplnspLN SURFACE PRESSURE [hPa]pslcSURFACE PRESSURE [hPa]pslmmaskMASK [-/+]mxwuMAXIMUM U-WIND [m/s]mxwvMAXIMUM V-WIND [m/s]capecinelhcvmscvscvmscvhmxwpMAXIMUM WIND PRESS. LVL [hPa]ustrSTORM MOTION U-COMPONENT [m/s]vstrSTORM MOTION V-COMPONENT [m/s]cbntMEAN CLOUD COVER [0-1]pcbsPRESSURE AT CLOUD BASE [hPa]pctpPRESSURE AT CLOUD TOP [hPa]fzhtFREEZING LEVEL HEIGHT [m]fzrhfdltFLIGHT LEVELS TEMPERATURE [K]fdluFLIGHT LEVELS U-WIND [m/s]fdlvFLIGHT LEVELS V-WIND [m/s]tpppTROPOPAUSE PRESSURE [hPa]tpptTROPOPAUSE TEMPERATURE [K]tpputppvgvduGRAVITY WAVE DRAG DU/DT [m/s2]gvdvGRAVITY WAVE DRAG DV/DT [m/s2]gvusgvvsdvshhmfcvmflvadvnhcmlglhlgmssmavtgrzbslhBARE SOIL LATENT HEAT [Ws/m2]evppPOTENTIAL SFC EVAPORATION [m]rnofRUNOFF [kg/m2/s)]pitpINTERCEPTION LOSS [W/m2]vpcaqsfcusslSOIL WETNESS OF SURFACE [0-1]uzrsuzdsamdlSTORAGE ON CANOPY [m]amslSTORAGE ON GROUND [m]tsfcSURFACE TEMPERATURE [K]temstcasctmpTEMPERATURE AT CANOPY [K]tgscuvesSURFACE ZONAL WIND (U) [m/s]usstSURFACE ZONAL WIND STRESS [Pa]vvesvsstsuvfSURFACE MOMENTUM FLUX [W/m2]iswfghfllwbclwtcswecocaclwrhswrholisolicocisocicolesocesswgcroceswtchhdfhmdfhddfhvdfvdmsvdfuvdfvvdfhumrsvdccusmtvsmttsmtrsmtatmtstmtommtTIME MEAN DERIVED OMEGA [Pa/s]dvmtTIME MEAN DIVERGENCE [1/s]zhmtlnmtmkmtTIME MEAN MASK [-/+]vvmtomtmTIME MEAN OMEGA [cbar/s]ptmtpcmtrhmtmpmtsimtTIME MEAN SIGMADOT [1/s]uemtfcmtpsmttmmtpvmttvmtvtmtTIME MEAN VORTICITY [1/s]uvmtTIME MEAN ZONAL WIND (U) [m/s]pVORMaximum temperature [K]Minimum temperature [K]Dew-point depression [K]u-component of wind [m/s]v-component of wind [m/s]Vertical velocity [Pa/s]Relative vorticity [1/s]Relative divergence [1/s]Evaporation [mm/day]Cloud ice [kg/m^2]TPRATTotal precipitation [mm/day]LPRATSnWeSnowDLow cloud cover [%]Medium cloud cover [%]High cloud cover [%]SoilTSoil temperature [K]ROFWater run-off [mm/day]TSCCanopy temperature [K]TSGGround temperature [K]FGLUFGLVADUAVWVFGSVGFLXUWVFGSUADVAFRCVFRCVSFRSCGWDUAGWDVAUTHEVTHELTRSEvapotranspiration [W/m^2]LINTInterception loss [W/m^2]WSMXMaximum wind speed [m/s]ADHRAdiabatic heating rate [K/day]MSCMoisture storage on canopy [m]MSGSoilWSoil wetness [Proportion]SMCCWCloud liquid water [kg/m^2]Cloud liquid water [kg/kg]Cloud ice [kg/kg]MFLXBUpward mass flux [kg/m^2/s]ADMROzone mixing ratio [mg/kg]CNVUACNVVAVTYPEType of vegetationv1.8.1.2d (4-14) Wesley Ebisuzaki DWD-tables 2,201-205 (11-28-2005) Helmut P. Frank spectral: Luis Kornblueh (MPI) -ncep_ens ensemble info encoded in ncep format -i decode controlled by stdin (inventory list) -text/-ieee/-grib/-bin convert to text/ieee/grib/bin (default) -nh/-h output will have no headers/headers (default) -dwdgrib output dwd headers, grib (do not append) -H output will include PDS and GDS (-bin/-ieee only) -o [file] output file name, 'dump' is default -cmc [file] use NCEP tables for CMC (dangerous) Missing GDS, constant record .. cannot determine number of data points timerange %d P1 %d P2 %d TimeU %d nx %d ny %d GDS grid %d num_in_ave %d missing %d latlon: lat %f to %f by %f nxny %ld long %f to %f by %f, (%d x %d) scan %d mode %d bdsgrid %d thinned latlon: lat %f to %f by %f nxny %ld long %f to %f, %ld grid pts (%d x %d) scan %d mode %d bdsgrid %d gaussian: lat %f to %f long %f to %f by %f, (%d x %d) scan %d mode %d bdsgrid %d thinned gaussian: lat %f to %f long %f to %f, %ld grid pts (%d x %d) scan %d mode %d bdsgrid %d polar stereo: Lat1 %f Long1 %f Orient %f %s pole (%d x %d) Dx %d Dy %d scan %d mode %d Lambert Conf: Lat1 %f Lon1 %f Lov %f Latin1 %f Latin2 %f LatSP %f LonSP %f %s (%d x %d) Dx %f Dy %f scan %d mode %d Albers Equal-Area: Lat1 %f Lon1 %f Lov %f Latin1 %f Latin2 %f LatSP %f LonSP %f %s (%d x %d) Dx %f Dy %f scan %d mode %d Mercator: lat %f to %f by %f km nxny %ld long %f to %f by %f km, (%d x %d) scan %d mode %d Latin %f bdsgrid %d Semi-staggered Arakawa E-Grid: lat0 %f lon0 %f nxny %d dLat %f dLon %f (%d x %d) scan %d mode %d Semi-staggered Arakawa E-Grid (2D): lat0 %f lon0 %f nxny %d dLat %f dLon %f (tlm0d %f tph0d %f) scan %d mode %d Semi-staggered Arakawa B-Grid (2D): lat0 %f lon0 %f nxny %d dLat %f dLon %f (tlm0d %f tph0d %f) scan %d mode %d filled Arakawa E-Grid: lat0 %f lon0 %f nxny %d dLat %f dLon %f (%d x %d) scan %d mode %d rotated LatLon grid lat %f to %f lon %f to %f nxny %ld (%d x %d) dx %d dy %d scan %d mode %d transform: south pole lat %f lon %f rot angle %f Harmonic (spectral): pentagonal spectral truncation: nj %d nk %d nm %d min/max data %g %g num bits %d BDS_Ref %g DecScale %d BinScale %d Undefined parameter table (center %d-%d table %d), using NCEP-opn Virtual temperature based convective available pot. energy [J/Kg]Ocean Mixed Layer Potential density (Referenced to 2000m) [kg/m^3]East-West component of sub-gridscale orographic variance [m**2]North-South component of sub-gridscale orographic variance [m**2]North-West/South-East component of sub-gridscale orographic variance [m**2]North-East/South-West component of sub-gridscale orographic variance [m**2]Maximum temperature at 2 metres since previous post-processing [K]Minimum temperature at 2 metres since previous post-processing [K]Total precipitation from observations [Millimetres*100 + number of stations]Humidity tendency by large-scale condensation [kg kg**-1 s**-1]Vertically integrated zonal velocity (previous time step) [m**2 s**-1]Vertically Integrated meridional velocity (previous time step) [m**2 s**-1]Vertically integrated meridional heat transport [J m**-1 s**-1]Zonal Velocity increment (from balance operator) [m/s per time step]Temperature increment from relaxation term [deg C per time step]Vertical integral of total column liquid cloud water [kg m**-2]Vertical integral of total column frozen cloud water [kg m**-2]Vertical integral of eastward water vapour flux [kg m**-1 s**-1]Vertical integral of northward water vapour flux [kg m**-1 s**-1]Vertical integral of divergence of kinetic energy flux [W m**-2]Vertical integral of divergence of thermal energy flux [W m**-2]Vertical integral of divergence of moisture flux [kg m**-2 s**-1]Stratiform precipitation (Large-scale precipitation) anomaly [m s**-1]Snowfall (convective + stratiform) anomalous rate of accumulation [m of water equivalent s**-1]Sunshine duration anomalous rate of accumulation [dimensionless]Downward surface solar radiation [W m**-2 s (W m**-2 for monthly means)]Downward surface long wave radiation [W m**-2 s (W m**-2 for monthly means)]Surface net solar radiation [W m**-2 s (W m**-2 for monthly means)]Surface net long wave radiation [W m**-2 s (W m**-2 for monthly means)]Top net solar radiation [W m**-2 s (W m**-2 for monthly means)]Top net long wave radiation [W m**-2 s (W m**-2 for monthly means)]Anthropogenic Emissions of Sulphur Hexafluoride [kg m**-2 s**-1]Minimum vertical gradient of refractivity inside trapping layer [m**-1]Mean vertical gradient of refractivity inside trapping layer [m**-1]Integrated Column Particulate matter (fine) [log10(ug/m^2)] wneDerived radar reflectivity backscatter from parameterized convection [mm^6/m^3]Biogenically Originated Particulates ≤ 2.5 μm Diameter [μg/m^3]Unspecified Anthropogenic Particulates ≤ 2.5 μm Diameter [μg/m^3]Sulfate (SO4) Particulates between 2.5 and 10 μm Diameter [μg/m^3]Sodium (NA) Particulates between 2.5 and 10 μm Diameter [μg/m^3]Chloride (CL) Particulates between 2.5 and 10 μm Diameter [μg/m^3]Sea Salt Originated Particulates between 2.5 and 10 μm Diameter [μg/m^3]Crustal Material Orginated Particulates between 2.5 and 10 μm Diameter [μg/m^3]Number Concentration Particulates between 2.5 and 0.1 μm Diameter [number/m^3]Number Concentration Particulates between 2.5 and 2.5 μm Diameter [number/m^3]Number Concentration Particulates between 2.5 and 10 μm Diameter [number/m^3]Surface Area Contributed by Particulates ≤ 0.1 μm Diameter [m2/m^3]Surface Area Contributed by Particulates between 0.1 and 2.5 μm Diameter [m2/m^3]vertical mountain wave momentum flux (X component) [kg/(m*s**2)]vertical mountain wave momentum flux (Y component) [kg/(m*s**2)]Sonnenbrand-Index bei mittl. Bewoelkung (08z-12z) [(W*10**(-3))/m**2]Kanadischer UVB-Warnindex (bew|lkungsreduziert) [(W*10**(-3))/m**2]direction and height of wind waves (dd*1000 + h) [1*degree, 1*cm]mean direction and height of waves (dd*1000 + h) [1*degree, 1*cm]Q-vector direction and speed (dd*1000 + fff*1E13) [5*deg,1E13*m**2/kg/s]Frontogenesefunktion, Q isother-senkrecht-Kompon. [m**2/(kg*s)]Qs (geo),Komp. Q-Vektor parallel zu den Isothermen [m**2/(kg*s)]geopotential RMS-error init. analysis - analysis [(m**2)/(s**2)]kinetic energy RMS-error first guess - analysis [(m**2)/(s**2)] Portable Grib decoder for %s etc. usage: %s [grib file] [options] Inventory/diagnostic-output selections -s/-v short/verbose inventory -V diagnostic output (not inventory) (none) regular inventory -PDS/-PDS10 print PDS in hex/decimal -GDS/-GDS10 print GDS in hex/decimal -verf print forecast verification time -ncep_opn/-ncep_rean default T62 NCEP grib table -4yr print year using 4 digits -min print minutes -d [record number|all] decode record number -p [byte position] decode record at byte position (none) no decoding -append append to output file error, could not read to end of record %ld Len of grib message is inconsistent. grib header at record %ld: two values of nxny %ld %d LEN %d DataStart %d UnusedBits %d #Bits %d nxny %ld %s kpds5=%d kpds6=%d kpds7=%d levels=(%d,%d) grid=%d center %d subcenter %d process %d Table %d Associated Legendre polynomials Triangular grid: nd %d ni %d (= 2^%d x 3^%d) kpds5=%d:kpds6=%d:kpds7=%d:TR=%d:P1=%d:P2=%d:TimeU=%d:*** Cannot decode complex packed fields n=%d*** add_time: undefined time unit %d planetary boundary layer (from Richardson no.)lowest bottom level of supercooled liequid water layerhighest top level of supercooled liquid water layerillegal gribtab center/subcenter/ptable line: %s Using NCEP %s table, see -ncep_opn, -ncep_rean options 0-%d%s product:same-hour,ave@1yr:%d-%d%s fcst-fcst_mean:rms@1yr:grib2 message ignored (use wgrib2) ICAO Standard Atmosphere Reference Height [M]Pseudo-adiabatic pot. temp. [K]Parcel lifted index (to 500 hPa) [K]Geopotential height anomaly [gpm]Montgomery stream function [m^2/s^2]Sigma coord. vertical velocity [/s]Pressure vertical velocity [Pa/s]Geometric vertical velocity [m/s]Large scale precipitation [kg/m^2]Convective precipitation [kg/m^2]Snowfall rate water equiv. [kg/m^2/s]Transient thermocline depth [m]Best lifted index (to 500 hPa) [K]Land cover (land=1;sea=0) [fraction]Deviation of sea level from mean [m]Ice concentration (ice=1;no ice=0) [fraction]Sig height of wind waves and swell [m]Net short wave (surface) [W/m^2]Net long wave (surface) [W/m^2]Radiance with respect to wave no. [W/m/sr]Radiance with respect ot wave len. [W/m^3/sr]Boundary layer dissipation [W/m^2]Meridional momentum flux [N/m^2]Mean sea level pressure (Std Atm) [Pa]Mean sea level pressure (MAPS) [Pa]Mean sea level pressure (ETA model) [Pa]Best (4-layer) lifted index [K]Horizontal moisture divergence [kg/kg/s]3-hr pressure tendency (Std Atmos Red) [Pa/s]Brunt-Vaisala frequency^2 [1/s^2]Potential vorticity (mass-weighted) [1/s/m]Categorical freezing rain [yes=1;no=0]Categorical ice pellets [yes=1;no=0]Volumetric soil moisture [fraction]Potential evaporation rate [W/m^2]Zonal gravity wave stress [N/m^2]Meridional gravity wave stress [N/m^2]Covariance between u and v [m^2/s^2]Covariance between u and T [K*m/s]Covariance between v and T [K*m/s]Convective Avail. Pot. Energy [J/kg]Turbulent kinetic energy [J/kg]Lifted parcel condensation pressure [Pa]Clear sky upward solar flux [W/m^2]Clear sky downward solar flux [W/m^2]Clear sky upward long wave flux [W/m^2]Clear sky downward long wave flux [W/m^2]Cloud forcing net solar flux [W/m^2]Cloud forcing net long wave flux [W/m^2]Visible beam downward solar flux [W/m^2]Visible diffuse downward solar flux [W/m^2]Near IR beam downward solar flux [W/m^2]Near IR diffuse downward solar flux [W/m^2]Rain water mixing ratio [kg/kg]Mass point model surface [non-dim]Velocity point model surface [non-dim]Model layer number (from bottom up) [non-dim]x-gradient of log pressure [1/m]y-gradient of log pressure [1/m]Turbulence SIGMET/AIRMET [non-dim]Rate of water dropping from canopy to gnd [kg/m^2]Storm relative helicity [m^2/s^2]Prob. from ensemble norm. to clim. expect. [non-dim]Prob. of frozen precipitation [%]Prob. of freezing precipitation [%]u-component of storm motion [m/s]v-component of storm motion [m/s]Direct evaporation from bare soil [W/m^2]Canopy water evaporation [W/m^2]Convective weather detection index []Downward short wave flux [W/m^2]Downward long wave flux [W/m^2]Exchange coefficient [(kg/m^3)(m/s)]No. of mixed layers next to surface [integer]Convective precip. rate [kg/m^2/s]Temp. tendency by all physics [K/s]Temp. tendency by all radiation [K/s]Temp. tendency by non-radiation physics [K/s]Precip index (0.0-1.00) [fraction]Std. dev. of IR T over 1x1 deg area [K]Natural log of surface pressure [ln(kPa)]Planetary boundary layer height [m]5-wave geopotential height [gpm]Plant canopy surface water [kg/m^2]Vegetation type (as in SiB) [0..13]Blackadar's mixing length scale [m]Asymptotic mixing length scale [m]Snow phase-change heat flux [W/m^2]5-wave geopot. height anomaly [gpm]Convective cloud mass flux [Pa/s]Downward total radiation flux [W/m^2]Upward total radiation flux [W/m^2]Baseflow-groundwater runoff [kg/m^2]Supercooled large droplet (SLD) icing pot. diagn. []Large scale condensation heating [K/s]Deep convective moistening [kg/kg/s]Shallow convective heating [K/s]Shallow convective moistening [kg/kg/s]Vertical diffusion heating [K/s]Vertical diffusion zonal accel [m/s^2]Vertical diffusion meridional accel [m/s^2]Vertical diffusion moistening [kg/kg/s]Longwave radiative heating [K/s]Ice concentration [ice=1;no ice=0]Moisture flux divergence [gr/gr*m/s/m]Mass point model surface [integer]Velocity point model surface [integer]Std dev of meridional wind [m/s]Covar. u and specific hum [m/s*gm/gm]Covar. v and specific hum [m/s*gm/gm]Covar. spec. hum and omega [gm/gm*Pa/s]Std dev of time tend of geop. hgt [m]Std dev of time tend of zonal wind [m/s]Std dev of time tend of merid wind [m/s]Downward solar radiation flux [W/m^2]Std dev of time tend of spec. hum [gm/gm]Exchange coefficient [kg*m/m^3/s]No. of mixed layers next to sfc [integer]Std dev of time tend of temp. [K]Upward solar radiation flux [W/m^2]Temp. tendency by nonrad physics [K/s]Std dev of IR T over 1x1 deg area [K]Std dev of time tend of rel hum [%]Max. stomato plant resistance [s/m]Snow sublimation heat flux [W/m^2]Land-sea coverage (land=1;sea=0) [fraction]Pressure (nearest grid point) [Pa]Lightning strike density [1/m^2/s]Volumetric soil moisture (frozen + liquid) [fraction]Vegetation canopy temperature [K]Bare soil surface skin temperature [K]Average surface skin temperature [K]Effective radiative skin temperature [K]Liquid soil moisture content (non-frozen) [kg/m^2]Open water evaporation (standing water) [W/m^2]Convective available potential energy [J/kg]Turbulent Kinetic Energy [J/kg]Liquid volumetric soil moisture (non-frozen) [fraction]Frozen precipitation (e.g. snowfall) [kg/m^2]Liquid precipitation (rainfall) [kg/m^2]Snow temperature, depth-avg [K]Number of soil layers in root zone [non-dim]Leaf area index (0-9) [non-dim]Snow albedo (over snow cover area only) [%]Normalized Difference Vegetation Index []Land-sea coverage (nearest neighbor) [land=1,sea=0]Latitude (nearest neigbhbor) (-90 to +90) [deg]East longitude (nearest neigbhbor) (0-360) [deg]Sublimation (evaporation from snow) [W/m^2]Total precipitation (nearest grid point) [kg/m^2]Minimal stomatal resistance [s/m]Downward shortwave radiation flux [W/m^2]Downward longwave radiation flux [W/m^2]Convective precipitation (nearest grid point) [kg/m^2]Upward short wave radiation flux [W/m^2]Upward long wave radiation flux [W/m^2]Geopotential Height (nearest grid point) [gpm]Blackadars mixing length scale [m]Transpiration stress-onset (soil moisture) [fraction]Direct evaporation cease (soil moisture) [fraction]water vapor added by precip assimilation [kg/m^2]water condensate added by precip assimilaition [kg/m^2]Subsurface runoff (baseflow) [kg/m^2]Surface runoff (non-infiltrating) [kg/m^2]Water vapor flux convergence (vertical int) [kg/m^2]Water condensate flux convergence (vertical int) [kg/m^2]Water vapor zonal flux (vertical int)[kg/m]Water vapor meridional flux (vertical int) [kg/m]Water condensate zonal flux (vertical int) [kg/m]Water condensate meridional flux (vertical int) [kg/m]Solar parameter in canopy conductance [fraction]Temperature parameter in canopy conductance [fraction]Humidity parameter in canopy conductance [fraction]Soil moisture parameter in canopy conductance [fraction]Surface drag coefficient [non-dim]Surface friction velocity [m/s]Liquid soil moisture content (non-frozen) [Kg/m^2]Number concentration for rain particles [-]Land Surface Precipitation Accumulation [kg/m^2]Convective available potential energy [J/Kg]Turbulent Kinetic Energy [J/Kg]Frozen precipitation (e.g. snowfall) [Kg/m^2]Liquid precipitation (rainfall) [Kg/m^2]Virtual temperature based convective inhibition [J/kg]Vertically integrated liquid [Kg/m^2]Exchange coefficient [(Kg/m^3)(m/s)]Plant canopy surface water [Kg/m^2]Subsurface runoff (baseflow) [Kg/m^2]Surface runoff (non-infiltrating) [Kg/m^2]Simulated brightness temp for GOES11, channel 2 [K]Simulated brightness temp for GOES11, channel 3 [K]Simulated brightness temp for GOES11, channel 4 [K]Simulated brightness temp for GOES11, channel 5 [K]Sim brightness tmp for AMSRE on Aqua channel 9 [K]Sim brightness tmp for AMSRE on Aqua channel 10 [K]Sim brightness tmp for AMSRE on Aqua channel 11 [K]Sim brightness tmp for AMSRE on Aqua channel 12 [K]Gravity wave drag u accelerationGravity wave drag v accelerationConvective u momentum mixing accelerationConvective v momentum mixing accelerationSfc exchange coeff for T and Q divided by delta zSfc exchange coeff for U and V divided by delta zMeridional overturning stream function [10^6m^3/s]Convective gravity wave drag zonal accelerationConvective gravity wave drag meridional accelerationTheta at top of viscous sublayerCovariance between psfc and psfcMaximum specific humidity at 2mMinimum specific humidity at 2mConvective detrainment mass fluxCovariance between omega and omegaOzone production from col ozone termOcean depth - instantaneous [m]Ocean surface elevation relative to geoid [m]Max ocean surface elevation in last 24 hours [m]Min ocean surface elevation in last 24 hours [m]S11 - 1,1 component of ice stress tensor []S12 - 1,2 component of ice stress tensor []S22 - 2,2 component of ice stress tensor []T1 - First invariant of stress tensor []T2 - Second invariant of stress tensor []Master length scale (turbulence) [m]Net Air-Ocean heat flux [W/m^2]Net Ice-Ocean heat flux [W/m^2]Ocean Mixed Layer Temperature [K]Ocean Mixed Layer Salinity [kg/kg]U Velocity in mixed layer [m/s]V Velocity in mixed layer [m/s]Assimilative Salt Flux [mm/day]Evaporation - Precipitation [cm/day]Surface Temperature Trend [K/day]Surface Salinity Trend [psu/day]Ocean vertical heat diffusivity [m^2/s]Ocean vertical salt diffusivity [m^2/s]Ocean vertical momementum diffusivity [m^2/s]Relative Error Variance [pure number]Velocity potential [m**2 s**-1]Equivalent potential temperature [K]Saturated equivalent potential temperature [K]U component of divergent wind [m s**-1]V component of divergent wind [m s**-1]U component of rotational wind [m s**-1]V component of rotational wind [m s**-1]UV visible albedo for direct radiation [(0 - 1)]UV visible albedo for diffuse radiation [(0 - 1)]Near IR albedo for direct radiation [(0 - 1)]Near IR albedo for diffuse radiation [(0 - 1)]Clear sky surface UV [W m**-2 s]Clear sky surface PAR [W m**-2 s]Unbalanced component of temperature [K]Unbalanced component of logarithm of surface pressure []Unbalanced component of divergence [s**-1]Reserved for future unbalanced components []High vegetation cover [(0 - 1)]Ice surface temperature layer 1 [K]Ice surface temperature layer 2 [K]Ice surface temperature layer 3 [K]Ice surface temperature layer 4 [K]Volumetric soil water layer 1 [m**3 m**-3]Volumetric soil water layer 2 [m**3 m**-3]Volumetric soil water layer 3 [m**3 m**-3]Volumetric soil water layer 4 [m**3 m**-3]Direct solar radiation [w m**-2]Magnitude of surface stress [N m**-2 s]Large-scale precipitation fraction [s]Maximum temperature at 2 metres since last 24 hours [K]Minimum temperature at 2 metres since last 24 hours [K]Montgomery potential [m**2 s**-2]Mean temperature at 2 metres since last 24 hours [K]Mean 2 metre dewpoint temperature in past 24 hours [K]Downward UV radiation at the surface [w m**-2 s]Photosynthetically active radiation at the surface [w m**-2 s]Convective available potential energy [J kg**-1]Potential vorticity [K m**2 kg**-1 s**-1]Start time for skin temperature difference [s]Finish time for skin temperature difference [s]Skin temperature difference [K]Leaf area index, low vegetation [m**2 / m**2]Leaf area index, high vegetation [m**2 / m**2]Minimum stomatal resistance, low vegetation [s m**-1]Minimum stomatal resistance, high vegetation [s m**-1]Biome cover, low vegetation [(0 - 1)]Biome cover, high vegetation [(0 - 1)]Instantaneous surface solar radiation downwards [w m**-2]Instantaneous surface thermal radiation downwards [w m**-2]Standard deviation of filtered subgrid orography [m]Cloud rain water content [kg kg**-1]Cloud snow water content [kg kg**-1]Eta-coordinate vertical velocity [s**-1]Total column liquid water [kg m**-2]Total column ice water [kg m**-2]Maximum temperature at 2 metres since last 6 hours [K]Minimum temperature at 2 metres since last 6 hours [K]10 metre wind gust in the past 6 hours [m s**-1]Surface emissivity [dimensionless]Vertically integrated total energy [J m**-2]Generic parameter for sensitive area prediction [Various]Total column water vapour [kg m**-2]Soil wetness level 1 [m of water]Snow depth [m of water equivalent]Stratiform precipitation (Large-scale precipitation) [m]Snowfall [m of water equivalent]Boundary layer dissipation [W m**-2 s]Surface sensible heat flux [W m**-2 s]Surface latent heat flux [W m**-2 s]Surface net radiation [W m**-2 s]Logarithm of surface pressure []Tendency of surface pressure [Pa s**-1]Standard deviation of orography []Anisotropy of sub-gridscale orography []Angle of sub-gridscale orography [rad]Slope of sub-gridscale orography []10 metre U wind component [m s**-1]10 metre V wind component [m s**-1]2 metre dewpoint temperature [K]Surface solar radiation downwards [W m**-2 s]Soil wetness level 2 [m of water]Surface thermal radiation downwards [W m**-2 s]Surface solar radiation [W m**-2 s]Surface thermal radiation [W m**-2 s]Top solar radiation [W m**-2 s]Top thermal radiation [W m**-2 s]East-West surface stress [N m**-2 s]North-South surface stress [N m**-2 s]Soil wetness level 3 [m of water]Convective cloud cover [(0 - 1)]Latitudinal component of gravity wave stress [N m**-2 s]Meridional component of gravity wave stress [N m**-2 s]Gravity wave dissipation [W m**-2 s]Skin reservoir content [m of water]Variance of sub-gridscale orography [m**2]Ozone mass mixing ratio [kg kg**-1]Precipitation analysis weights []Top net solar radiation, clear sky [W m**-2 s]Top net thermal radiation, clear sky [W m**-2 s]Surface net solar radiation, clear sky [W m**-2 s]Surface net thermal radiation, clear sky [W m**-2 s]TOA incident solar radiation [W m**-2 s]Vertically integrated moisture divergence [kg m**-2]Diabatic heating by radiation [K]Diabatic heating by vertical diffusion [K]Diabatic heating by cumulus convection [K]Diabatic heating large-scale condensation [K]Vertical diffusion of zonal wind [m s**-1]Vertical diffusion of meridional wind [m s**-1]East-West gravity wave drag tendency [m s**-1]North-South gravity wave drag tendency [m s**-1]Convective tendency of zonal wind [m s**-1]Convective tendency of meridional wind [m s**-1]Vertical diffusion of humidity [kg kg**-1]Humidity tendency by cumulus convection [kg kg**-1]Humidity tendency by large-scale condensation [kg kg**-1]Change from removal of negative humidity [kg kg**-1]Instantaneous X surface stress [N m**-2]Instantaneous Y surface stress [N m**-2]Instantaneous surface heat flux [W m**-2]Instantaneous moisture flux [kg m**-2 s**-1]Apparent surface humidity [kg kg**-1]Logarithm of surface roughness length for heat []Convective snowfall [m of water equivalent]Large-scale snowfall [m of water equivalent]Accumulated cloud fraction tendency [(-1 to 1)]Accumulated liquid water tendency [(-1 to 1)]Forecast logarithm of surface roughness for heat []Cloud liquid water content [kg kg**-1]Cloud ice water content [kg kg**-1]Accumulated ice water tendency [(-1 to 1)]Adiabatic tendency of temperature [K]Adiabatic tendency of humidity [kg kg**-1]Adiabatic tendency of zonal wind [m s**-1]Adiabatic tendency of meridional wind [m s**-1]Maximum 2 metre temperature [K]Minimum 2 metre temperature [K]Mean 2 metre temperature in past 24 hours [K]Maximum temperature at 2 metres [K]Minimum temperature at 2 metres [K]Snowfall (convective + stratiform) [m of water equivalent]Instantaneous moisture flux [kg m**-2 s]Top solar radiation upward [W m**-2]Top thermal radiation upward [W m**-2]Top solar radiation upward, clear sky [W m**-2]Top thermal radiation upward, clear sky [W m**-2]Diabatic heating by radiation [K s**-1]Diabatic heating by vertical diffusion [K s**-1]Diabatic heating by cumulus convection [K s**-1]Diabatic heating by large-scale condensation [K s**-1]Vertical diffusion of zonal wind [m**2 s**-3]Vertical diffusion of meridional wind [m**2 s**-3]East-West gravity wave drag [m**2 s**-3]North-South gravity wave drag [m**2 s**-3]Convective tendency of zonal wind [m**2 s**-3]Convective tendency of meridional wind [m**2 s**-3]Vertical diffusion of humidity [kg kg**-1 s**-1]Humidity tendency by cumulus convection [kg kg**-1 s**-1]Change from removal of negative humidity [kg kg**-1 s**-1]Adiabatic tendency of temperature [K s**-1]Adiabatic tendency of humidity [kg kg**-1 s**-1]Adiabatic tendency of zonal wind [m**2 s**-3]Adiabatic tendency of meridional wind [m**2 s**-3]Mean vertical velocity [Pa s**-1]2m temperature anomaly of at least +2K [%]2m temperature anomaly of at least +1K [%]2m temperature anomaly of at least 0K [%]2m temperature anomaly of at most -1K [%]2m temperature anomaly of at most -2K [%]Total precipitation anomaly of at least 20 mm [%]Total precipitation anomaly of at least 10 mm [%]Total precipitation anomaly of at least 0 mm [%]Surface temperature anomaly of at least 0K [%]Mean sea level pressure anomaly of at least 0 Pa [%]Heigth of 0 degree isotherm probability [percentage]Heigth of snowfall limit probability [percentage]Showalter index probability [percentage]Whiting index probability [percentage]Temperature anomaly less than -2 K [%]Temperature anomaly of at least +2 K [%]Temperature anomaly less than -8 K [%]Temperature anomaly less than -4 K [%]Temperature anomaly greater than +4 K [%]Temperature anomaly greater than +8 K [%]10 metre wind gust probability [percentage]Convective available potential energy probability [percentage]Total precipitation of at least 1 mm [%]Total precipitation of at least 5 mm [%]Total precipitation of at least 10 mm [%]Total precipitation of at least 20 mm [%]Total precipitation less than 0.1 mm [%]Total precipitation rate less than 1 mm per day [%]Total precipitation rate of at least 3 mm per day [%]Total precipitation rate of at least 5 mm per day [%]10 metre Wind speed of at least 10 metre per second [%]10 metre Wind speed of at least 15 metre per second [%]10 metre Wind gust of at least 15 metre per second [%]10 metre Wind gust of at least 20 metre per second [%]10 metre Wind gust of at least 25 metre per second [%]2 metre temperature less than 273.15 K [%]Significant wave height of at least 2 m [%]Significant wave height of at least 4 m [%]Significant wave height of at least 6 m [%]Significant wave height of at least 8 m [%]Mean wave period of at least 8 s [%]Mean wave period of at least 10 s [%]Mean wave period of at least 12 s [%]Mean wave period of at least 15 s [%]Total precipitation of at least 40 mm [%]Total precipitation of at least 60 mm [%]Total precipitation of at least 80 mm [%]Total precipitation of at least 100 mm [%]Total precipitation of at least 150 mm [%]Total precipitation of at least 200 mm [%]Total precipitation of at least 300 mm [%]Temperature anomaly probability [percentage]2 metre temperature probability [%]Snowfall probability [percentage]Total precipitation probability [%]Total cloud cover probability [percentage]10 metre speed probability [percentage]2 metre temperature probability [percentage]Maximum 2 metre temperature probability [percentage]Minimum 2 metre temperature probability [percentage]Total precipitation probability [percentage]Significant wave height probability [percentage]Mean wave period probability [percentage]10 metre wind gust index [(-1 to 1)]10 metre speed index [(-1 to 1)]2 metre temperature index [(-1 to 1)]Maximum of significant wave height index [(-1 to 1)]Maximum temperature at 2 metres index [(-1 to 1)]Minimum temperature at 2 metres index [(-1 to 1)]Total precipitation index [(-1 to 1)]2m temperature probability less than -10 C [%]2m temperature probability less than -5 C [%]2m temperature probability less than 0 C [%]2m temperature probability less than 5 C [%]2m temperature probability less than 10 C [%]2m temperature probability greater than 25 C [%]2m temperature probability greater than 30 C [%]2m temperature probability greater than 35 C [%]2m temperature probability greater than 40 C [%]2m temperature probability greater than 45 C [%]Minimum 2 metre temperature probability less than -10 C [%]Minimum 2 metre temperature probability less than -5 C [%]Minimum 2 metre temperature probability less than 0 C [%]Minimum 2 metre temperature probability less than 5 C [%]Minimum 2 metre temperature probability less than 10 C [%]Maximum 2 metre temperature probability greater than 25 C [%]Maximum 2 metre temperature probability greater than 30 C [%]Maximum 2 metre temperature probability greater than 35 C [%]Maximum 2 metre temperature probability greater than 40 C [%]Maximum 2 metre temperature probability greater than 45 C [%]10 metre wind speed probability of at least 10 m/s [%]10 metre wind speed probability of at least 15 m/s [%]10 metre wind speed probability of at least 20 m/s [%]10 metre wind speed probability of at least 35 m/s [%]10 metre wind speed probability of at least 50 m/s [%]10 metre wind gust probability of at least 20 m/s [%]10 metre wind gust probability of at least 35 m/s [%]10 metre wind gust probability of at least 50 m/s [%]10 metre wind gust probability of at least 75 m/s [%]10 metre wind gust probability of at least 100 m/s [%]Total precipitation probability of at least 1 mm [%]Total precipitation probability of at least 5 mm [%]Total precipitation probability of at least 10 mm [%]Total precipitation probability of at least 20 mm [%]Total precipitation probability of at least 40 mm [%]Total precipitation probability of at least 60 mm [%]Total precipitation probability of at least 80 mm [%]Total precipitation probability of at least 100 mm [%]Total precipitation probability of at least 150 mm [%]Total precipitation probability of at least 200 mm [%]Total precipitation probability of at least 300 mm [%]Snowfall probability of at least 1 mm [%]Snowfall probability of at least 5 mm [%]Snowfall probability of at least 10 mm [%]Snowfall probability of at least 20 mm [%]Snowfall probability of at least 40 mm [%]Snowfall probability of at least 60 mm [%]Snowfall probability of at least 80 mm [%]Snowfall probability of at least 100 mm [%]Snowfall probability of at least 150 mm [%]Snowfall probability of at least 200 mm [%]Snowfall probability of at least 300 mm [%]Total Cloud Cover probability greater than 10% [%]Total Cloud Cover probability greater than 20% [%]Total Cloud Cover probability greater than 30% [%]Total Cloud Cover probability greater than 40% [%]Total Cloud Cover probability greater than 50% [%]Total Cloud Cover probability greater than 60% [%]Total Cloud Cover probability greater than 70% [%]Total Cloud Cover probability greater than 80% [%]Total Cloud Cover probability greater than 90% [%]Total Cloud Cover probability greater than 99% [%]High Cloud Cover probability greater than 10% [%]High Cloud Cover probability greater than 20% [%]High Cloud Cover probability greater than 30% [%]High Cloud Cover probability greater than 40% [%]High Cloud Cover probability greater than 50% [%]High Cloud Cover probability greater than 60% [%]High Cloud Cover probability greater than 70% [%]High Cloud Cover probability greater than 80% [%]High Cloud Cover probability greater than 90% [%]High Cloud Cover probability greater than 99% [%]Medium Cloud Cover probability greater than 10% [%]Medium Cloud Cover probability greater than 20% [%]Medium Cloud Cover probability greater than 30% [%]Medium Cloud Cover probability greater than 40% [%]Medium Cloud Cover probability greater than 50% [%]Medium Cloud Cover probability greater than 60% [%]Medium Cloud Cover probability greater than 70% [%]Medium Cloud Cover probability greater than 80% [%]Medium Cloud Cover probability greater than 90% [%]Medium Cloud Cover probability greater than 99% [%]Low Cloud Cover probability greater than 10% [%]Low Cloud Cover probability greater than 20% [%]Low Cloud Cover probability greater than 30% [%]Low Cloud Cover probability greater than 40% [%]Low Cloud Cover probability greater than 50% [%]Low Cloud Cover probability greater than 60% [%]Low Cloud Cover probability greater than 70% [%]Low Cloud Cover probability greater than 80% [%]Low Cloud Cover probability greater than 90% [%]Low Cloud Cover probability greater than 99% [%]Maximum of significant wave height [m]U-component stokes drift [m s**-1]V-component stokes drift [m s**-1]Period corresponding to maximum individual wave height [s]Maximum individual wave height [m]Mean wave period based on first moment [s]Mean wave period based on second moment [s]Wave spectral directional width []Mean wave period based on first moment for wind waves [s]Mean wave period based on second moment for wind waves [s]Wave spectral directional width for wind waves []Mean wave period based on first moment for swell [s]Mean wave period based on second moment for swell [s]Wave spectral directional width for swell []Coefficient of drag with waves []Significant height of wind waves [m]Mean direction of wind waves [degrees]Significant height of total swell [m]Mean direction of total swell [degrees]Standard deviation wave height [m]Mean of 10 metre wind speed [m s**-1]Standard deviation of 10 metre wind speed [m s**-1]Mean square slope of waves [dimensionless]Altimeter corrected wave height [m]Altimeter range relative correction []10 metre wind direction [degrees]2D wave spectra (multiple) [m**2 s radian**-1]2D wave spectra (single) [m**2 s radian**-1]Wave spectral peakedness [s**-1]Ocean potential temperature [deg C]Ocean potential density [kg m**-3 -1000]Turbulent kinetic energy input []Diagnosed sea surface temperature error [deg C]Observed sea surface temperature [deg C]Ocean current zonal component [m s**-1]Ocean current meridional component [m s**-1]Ocean current vertical component [m s**-1]Modulus of strain rate tensor [s**-1]Vertical viscosity [m**2 s**-1]Vertical diffusivity [m**2 s**-1]Sea level previous timestep [m]Barotropic stream function [m**3 s**-1]Bottom Pressure (equivalent height) [m]Divergence of wind stress [Nm**-3]Turbulent kinetic energy input [W m**-2]Net surface heat flux [W m**-2]Absorbed solar radiation [W m**-2]Precipitation - evaporation [m s**-1]Specified sea surface temperature [deg C]Specified surface heat flux [W m**-2]Average potential temperature in the upper 300m [degrees C]Vertically integrated zonal volume transport [m**2 s**-1]Vertically integrated meridional volume transport [m**2 s**-1]Vertically integrated zonal heat transport [J m**-1 s**-1]Depth of the velocity maximum [m]Average salinity in the upper 300m [psu]Layer Thickness at scalar points [m]Layer Thickness at vector points [m]Potential temperature increment [deg C]Potential temperature analysis error [deg C]Background potential temperature [deg C]Analysed potential temperature [deg C]Potential temperature background error [deg C]Estimated Bias in Temperature [deg C]Estimated Bias in Salinity [psu]Meridional Velocity increment (from balance operator) []Salinity increment (from salinity data) [psu per time step]Salinity background error [psu]Estimated temperature bias from assimilation [deg C]Estimated salinity bias from assimilation [psu]Salinity increment from relaxation term []Bias in the zonal pressure gradient (applied) [Pa**m-1]Bias in the meridional pressure gradient (applied) [Pa**m-1]Estimated temperature bias from relaxation [deg C]Estimated salinity bias from relaxation [psu]First guess bias in temperature [deg C]First guess bias in salinity [psu]Bias in temperature(applied) [deg C]Bias in salinity (applied) [psu]10 metre wind gust during averaging time [m s**-1]Precipitable water content [kg m**-2]Large-scale precipitation [kg m**-2 s**-1]Convective precipitation [kg m**-2 s**-1]Boundary layer dissipation [W m**-2]Surface sensible heat flux [W m**-2]Surface latent heat flux [W m**-2]Surface solar radiation [W m**-2]Surface thermal radiation [W m**-2]Top thermal radiation [W m**-2]East-West surface stress [N m**-2 s**-1]North-South surface stress [N m**-2 s**-1]Maximum temperature at 2 metres during averaging time [K]Minimium temperature at 2 metres during averaging time [K]Standard deviation of geopotential [m**2 s**-2]Covariance of temperature and geopotential [K m**2 s**-2]Standard deviation of temperature [K]Covariance of specific humidity and geopotential [m**2 s**-2]Covariance of specific humidity and temperature [K]Standard deviation of specific humidity [(0 - 1)]Covariance of U component and geopotential [m**3 s**-3]Covariance of U component and temperature [K m s**-1]Covariance of U component and specific humidity [m s**-1]Standard deviation of U velocity [m s**-1]Covariance of V component and geopotential [m**3 s**-3]Covariance of V component and temperature [K m s**-1]Covariance of V component and specific humidity [m s**-1]Covariance of V component and U component [m**2 s**-2]Standard deviation of V component [m s**-1]Covariance of W component and geopotential [Pa m**2 s**-3]Covariance of W component and temperature [K Pa s**-1]Covariance of W component and specific humidity [Pa s**-1]Covariance of W component and U component [Pa m s**-2]Covariance of W component and V component [Pa m s**-2]Standard deviation of vertical velocity [Pa s**-1]Convective snowfall [kg m**-2 s**-1]Large-scale snowfall [kg m**-2 s**-1]Gravity wave dissipation flux [W m**-2]Heaviside beta function [(0 - 1)]Surface geopotential [m**2 s**-2]Vertical integral of mass of atmosphere [kg m**-2]Vertical integral of temperature [K kg m**-2]Vertical integral of total column water vapour [kg m**-2]Vertical integral of total column ozone [kg m**-2]Vertical integral of kinetic energy [J m**-2]Vertical integral of thermal energy [J m**-2]Vertical integral of dry static energy [J m**-2]Vertical integral of moist static energy [J m**-2]Vertical integral of total energy [J m**-2]Vertical integral of energy conversion [W m**-2]Vertical integral of eastward mass flux [kg m**-1 s**-1]Vertical integral of northward mass flux [kg m**-1 s**-1]Vertical integral of eastward kinetic energy flux [W m**-2]Vertical integral of northward kinetic energy flux [W m**-2]Vertical integral of eastward heat flux [W m**-2]Vertical integral of northward heat flux [W m**-2]Vertical integral of eastward geopotential flux [W m**-2]Vertical integral of northward geopotential flux [W m**-2]Vertical integral of eastward total energy flux [W m**-2]Vertical integral of northward total energy flux [W m**-2]Vertical integral of eastward ozone flux [kg m**-1 s**-1]Vertical integral of northward ozone flux [kg m**-1 s**-1]Vertical integral of divergence of mass flux [kg m**-2 s**-1]Vertical integral of divergence of geopotential flux [W m**-2]Vertical integral of divergence of total energy flux [W m**-2]Vertical integral of divergence of ozone flux [kg m**-2 s**-1]Tendency of short wave radiation [K]Tendency of long wave radiation [K]Tendency of clear sky short wave radiation [K]Tendency of clear sky long wave radiation [K]Downdraught mass flux [kg m**-2]Updraught detrainment rate [kg m**-3]Downdraught detrainment rate [kg m**-3]Total precipitation flux [kg m**-2]Turbulent diffusion coefficient for heat [m**2]Tendency of temperature due to physics [K]Tendency of specific humidity due to physics [kg kg**-1]Tendency of u component due to physics [m s**-1]Tendency of v component due to physics [m s**-1]Variance of geopotential [m**4 s**-4]Covariance of geopotential/temperature [m**2 K s**-2]Covariance of geopotential/specific humidity [m**2 s**-2]Covariance of temperature/specific humidity [K]Variance of specific humidity []Covariance of u component/geopotential [M**3 s**-3]Covariance of u component/temperature [m s**-1 K]Covariance of u component/specific humidity [m s**-1]Variance of u component [m**2 s**-2]Covariance of v component/geopotential [M**3 s**-3]Covariance of v component/temperaure [m s**-1 K]Covariance of v component/specific humidity [m s**-1]Covariance of v component/u component [m**2 s**-2]Variance of v component [m**2 s**-2]Covariance of omega/geopotential [m**2 Pa s**-3]Covariance of omega/temperature [Pa s**-1 K]Covariance of omega/specific humidity [Pa s**-1]Covariance of omega/u component [m Pa s**-2]Covariance of omega/v component [m Pa s**-2]Variance of omega [Pa**2 s**-2]Variance of surface pressure [Pa**2]Variance of relative humidity [dimensionless]Covariance of u component/ozone [m s**-1]Covariance of v component/ozone [m s**-1]Covariance of omega/ozone [Pa s**-1]Variance of ozone [dimensionless]Stream function anomaly [m**2 s**-1]Velocity potential anomaly [m**2 s**-1]Downward UV radiation at the surface [w m**-2]Photosynthetically active radiation at the surface [w m**-2]Total column liquid water anomaly [kg m**-2]Total column ice water anomaly [kg m**-2]Geopotential anomaly [m**2 s**-2]Mean sea level pressure anomaly [Pa]Total cloud cover anomaly [(0 - 1)]10 metre U wind component anomaly [m s**-1]10 metre V wind component anomaly [m s**-1]2 metre temperature anomaly [K]Maximum temperature at 2 metres anomaly [K]Minimum temperature at 2 metres anomaly [K]Diabatic heating by large-scale condensation [K]Total precipitation anomaly [m]Snow evaporation m of water s**-1magnitude of surface stress N m**-2Large-scale precipitation fraction -Large scale precipitation m s**-1Convective precipitation m s**-1Snowfall (convective + stratiform) m of water equivalent s**-1Boundary layer dissipation W m**-2Surface sensible heat flux W m**-2Surface latent heat flux W m**-2Short-wave heating rate K s**-1Surface solar radiation downwards W m**-2Surface thermal radiation downwards W m**-2Surface solar radiation W m**-2Surface thermal radiation W m**-2East-West surface stress N m**-2North-South surface stress N m**-2Latitudinal component of gravity wave stress N m**-2Meridional component of gravity wave stress N m**-2Gravity wave dissipation W m**-2Top net solar radiation, clear sky W m**-2Top net thermal radiation, clear sky W m**-2Surface net solar radiation, clear sky W m**-2Surface net thermal radiation, clear sky W m**-2Convective snowfall m of water equivalent s**-1Large-scale snowfall m of water equivalent s**-1Snow evaporation anomaly [m of water s**-1]Snowmelt anomaly [m of water s**-1]Magnitude of surface stress anomaly [N m**-2]Large-scale precipitation fraction anomaly []Convective precipitation anomaly [m s**-1]Boundary layer dissipation anomaly [W m**-2]Surface sensible heat flux anomaly [W m**-2]Surface latent heat flux anomaly [W m**-2]Surface net radiation anomaly [W m**-2]Short-wave heating rate anomaly [K s**-1]Long-wave heating rate anomaly [K s**-1]Surface solar radiation downwards anomaly [W m**-2]Surface thermal radiation downwards anomaly [W m**-2]Surface solar radiation anomaly [W m**-2]Surface thermal radiation anomaly [W m**-2]Top solar radiation anomaly [W m**-2]Top thermal radiation anomaly [W m**-2]East-West surface stress anomaly [N m**-2]North-South surface stress anomaly [N m**-2]Evaporation anomaly [m of water s**-1]Latitudinal component of gravity wave stress anomaly [N m**-2]Meridional component of gravity wave stress anomaly [N m**-2]Gravity wave dissipation anomaly [W m**-2]Top net solar radiation, clear sky anomaly [W m**-2]Top net thermal radiation, clear sky anomaly [W m**-2]Surface net solar radiation, clear sky anomaly [W m**-2]Surface net thermal radiation, clear sky anomaly [W m**-2]Solar insolation anomaly [W m**-2 s**-1]Total precipitation anomalous rate of accumulation [m s**-1]Convective snowfall anomaly [m of water equivalent s**-1]Large-scale snowfall anomaly [m of water equivalent s**-1]Fraction of sea-ice in sea [(0 - 1)]Open-sea surface temperature [K]10 metre wind gust over last 24 hours [m s**-1]1.5m temperature - mean over last 24 hours [K]Net primary productivity [kg C m**-2 s**-1]1.5m dewpoint temperature over land [K]Top incoming solar radiation [W m**-2 s]Top outgoing solar radiation [W m**-2 s]Mean sea surface temperature [K]1.5m specific humidity [kg kg**-1]Liquid water potential temperature [K]Ocean ice concentration [(0 - 1)]Average potential temperature in upper 293.4m [degrees C]Average salinity in upper 293.4m [psu]1.5m temperature - maximum over last 24 hours [K]1.5m temperature - minimum over last 24 hours [K]Surface solar radiation [J m**-2 s]Surface thermal radiation [J m**-2 s]Top solar radiation [J m**-2 s]Top thermal radiation [J m**-2 s]Evaporation [m (m s**-1 for monthly means)]Total precipitation [m (m s**-1 for monthly means)]Total soil moisture [m**3 m**-3]Sea Salt Aerosol (0.03 - 0.5 um) Mixing Ratio [kg kg**-1]Sea Salt Aerosol (0.5 - 5 um) Mixing Ratio [kg kg**-1]Sea Salt Aerosol (5 - 20 um) Mixing Ratio [kg kg**-1]Dust Aerosol (0.03 - 0.55 um) Mixing Ratio [kg kg**-1]Dust Aerosol (0.55 - 0.9 um) Mixing Ratio [kg kg**-1]Dust Aerosol (0.9 - 20 um) Mixing Ratio [kg kg**-1]Hydrophobic Organic Matter Aerosol Mixing Ratio [kg kg**-1]Hydrophilic Organic Matter Aerosol Mixing Ratio [kg kg**-1]Hydrophobic Black Carbon Aerosol Mixing Ratio [kg kg**-1]Hydrophilic Black Carbon Aerosol Mixing Ratio [kg kg**-1]Sulphate Aerosol Mixing Ratio [kg kg**-1]Aerosol type 12 mixing ratio [kg kg**-1]Aerosol type 1 source/gain accumulated [kg m**-2]Aerosol type 2 source/gain accumulated [kg m**-2]Aerosol type 3 source/gain accumulated [kg m**-2]Aerosol type 4 source/gain accumulated [kg m**-2]Aerosol type 5 source/gain accumulated [kg m**-2]Aerosol type 6 source/gain accumulated [kg m**-2]Aerosol type 7 source/gain accumulated [kg m**-2]Aerosol type 8 source/gain accumulated [kg m**-2]Aerosol type 9 source/gain accumulated [kg m**-2]Aerosol type 10 source/gain accumulated [kg m**-2]Aerosol type 11 source/gain accumulated [kg m**-2]Aerosol type 12 source/gain accumulated [kg m**-2]Aerosol type 1 sink/loss accumulated [kg m**-2]Aerosol type 2 sink/loss accumulated [kg m**-2]Aerosol type 3 sink/loss accumulated [kg m**-2]Aerosol type 4 sink/loss accumulated [kg m**-2]Aerosol type 5 sink/loss accumulated [kg m**-2]Aerosol type 6 sink/loss accumulated [kg m**-2]Aerosol type 7 sink/loss accumulated [kg m**-2]Aerosol type 8 sink/loss accumulated [kg m**-2]Aerosol type 9 sink/loss accumulated [kg m**-2]Aerosol type 10 sink/loss accumulated [kg m**-2]Aerosol type 11 sink/loss accumulated [kg m**-2]Aerosol type 12 sink/loss accumulated [kg m**-2]Aerosol precursor mixing ratio [kg kg**-1]Aerosol small mode mixing ratio [kg kg**-1]Aerosol large mode mixing ratio [kg kg**-1]Aerosol precursor optical depth [dimensionless]Aerosol small mode optical depth [dimensionless]Aerosol large mode optical depth [dimensionless]Dust emission potential [kg s**2 m**-5]Lifting threshold speed [m s**-1]Total column Carbon Dioxide [kg m**-2]Total column Methane [kg m**-2]Total column Nitrous oxide [kg m**-2]Ocean flux of Carbon Dioxide [kg m**-2 s**-1]Natural biosphere flux of Carbon Dioxide [kg m**-2 s**-1]Anthropogenic emissions of Carbon Dioxide [kg m**-2 s**-1]Methane Surface Fluxes [kg m**-2 s**-1]Methane loss rate due to radical hydroxyl (OH) [s**-1]Wildfire flux of Carbon Dioxide [kg m**-2 s**-1]Wildfire flux of Carbon Monoxide [kg m**-2 s**-1]Wildfire flux of Methane [kg m**-2 s**-1]Wildfire flux of Non-Methane Hydro-Carbons [kg m**-2 s**-1]Wildfire flux of Hydrogen [kg m**-2 s**-1]Wildfire flux of Nitrogen Oxides NOx [kg m**-2 s**-1]Wildfire flux of Nitrous Oxide [kg m**-2 s**-1]Wildfire flux of Particulate Matter PM2.5 [kg m**-2 s**-1]Wildfire flux of Total Particulate Matter [kg m**-2 s**-1]Wildfire flux of Total Carbon in Aerosols [kg m**-2 s**-1]Wildfire flux of Organic Carbon [kg m**-2 s**-1]Wildfire flux of Black Carbon [kg m**-2 s**-1]Wildfire overall flux of burnt Carbon [kg m**-2 s**-1]Wildfire fraction of C4 plants [dimensionless]Wildfire vegetation map index [dimensionless]Wildfire Combustion Completeness [dimensionless]Wildfire fraction of area burnt [dimensionless]Wildfire radiative power [W m**-2]Wildfire combustion rate [kg m**-2 s**-1]Total column Nitrogen dioxide [kg m**-2]Total column Sulphur dioxide [kg m**-2]Total column Carbon monoxide [kg m**-2]Total column Formaldehyde [kg m**-2]Total Column Nitrogen Oxides [kg m**-2]Reactive tracer 1 mass mixing ratio [kg kg**-1]Total column GRG tracer 1 [kg m**-2]Reactive tracer 2 mass mixing ratio [kg kg**-1]Total column GRG tracer 2 [kg m**-2]Reactive tracer 3 mass mixing ratio [kg kg**-1]Total column GRG tracer 3 [kg m**-2]Reactive tracer 4 mass mixing ratio [kg kg**-1]Total column GRG tracer 4 [kg m**-2]Reactive tracer 5 mass mixing ratio [kg kg**-1]Total column GRG tracer 5 [kg m**-2]Reactive tracer 6 mass mixing ratio [kg kg**-1]Total column GRG tracer 6 [kg m**-2]Reactive tracer 7 mass mixing ratio [kg kg**-1]Total column GRG tracer 7 [kg m**-2]Reactive tracer 8 mass mixing ratio [kg kg**-1]Total column GRG tracer 8 [kg m**-2]Reactive tracer 9 mass mixing ratio [kg kg**-1]Total column GRG tracer 9 [kg m**-2]Reactive tracer 10 mass mixing ratio [kg kg**-1]Total column GRG tracer 10 [kg m**-2]Surface flux Nitrogen oxides [kg m**-2 s**-1]Surface flux Nitrogen dioxide [kg m**-2 s**-1]Surface flux Sulphur dioxide [kg m**-2 s**-1]Surface flux Carbon monoxide [kg m**-2 s**-1]Surface flux Formaldehyde [kg m**-2 s**-1]Surface flux GEMS Ozone [kg m**-2 s**-1]Surface flux reactive tracer 1 [kg m**-2 s**-1]Surface flux reactive tracer 2 [kg m**-2 s**-1]Surface flux reactive tracer 3 [kg m**-2 s**-1]Surface flux reactive tracer 4 [kg m**-2 s**-1]Surface flux reactive tracer 5 [kg m**-2 s**-1]Surface flux reactive tracer 6 [kg m**-2 s**-1]Surface flux reactive tracer 7 [kg m**-2 s**-1]Surface flux reactive tracer 8 [kg m**-2 s**-1]Surface flux reactive tracer 9 [kg m**-2 s**-1]Surface flux reactive tracer 10 [kg m**-2 s**-1]Sulphur Hexafluoride [kg kg**-1]Total column Sulphur Hexafluoride [kg m**-2]GEMS Total column ozone [kg m**-2]Total Aerosol Optical Depth at 550nm [-]Sea Salt Aerosol Optical Depth at 550nm [-]Dust Aerosol Optical Depth at 550nm [-]Organic Matter Aerosol Optical Depth at 550nm [-]Black Carbon Aerosol Optical Depth at 550nm [-]Sulphate Aerosol Optical Depth at 550nm [-]Total Aerosol Optical Depth at 469nm [-]Total Aerosol Optical Depth at 670nm [-]Total Aerosol Optical Depth at 865nm [-]Total Aerosol Optical Depth at 1240nm [-]Convective inhibition [J kg**-1]Mean temperature at 2 metres [K]Mean total cloud cover [(0 - 1)]Lake total layer temperature [K]Lake shape factor [dimensionless]Neutral wind at 10 m x-component [m s**-1]Neutral wind at 10 m y-component [m s**-1]V-tendency from non-orographic wave drag [m s**-2]U-tendency from non-orographic wave drag [m s**-2]Snow Depth water equivalent [m]Snow Fall water equivalent [kg m**-2]Probability anomaly of temp [%]Probability anomaly of precip [%]Probability of wetting rain > 0.1 in [%]Rain fraction of total liquid water []Ice fraction of total condensate []Total column cloud water [kg/m/m]Total column cloud ice [kg/m/m]Total column condensate [kg/m/m]Pressure of level from which parcel was lifted [Pa]Height of level from which parcel was lifted [m]Effective Particle size [microns]Probability of Temp. above normal [%]Probability of Temp. near normal [%]Probability of Temp. below normal [%]Probability of Precip. above normal [%]Probability of Precip. near normal [%]Probability of Precip. below normal [%]Particulate matter (coarse) [ug/m^3]Particulate matter (fine) [ug/m^3]Analysis Error of Temperature [K]Analysis Error of Dew Point [K]Analysis Error of Specific Humidity [kg/kg] wneParticulate matter (fine) [log10(ug/m^3)]Derived radar reflectivity backscatter from rain [mm^6/m^3]Derived radar reflectivity backscatter from ice [mm^6/m^3]Integrated supercooled liquid water [kg/m^2]Total Column Integrated Melting Ice [kg/m^2]Seconds prior to initial reference time [sec]Seconds after initial reference time [sec]Number of samples/observations [non-dim]Analysis Error of Pressure [Pa]Low-level Aviation Interest [non-dim]High-level Aviation Interest [non-dim]Categorical ozone concentration [?]vertical heat eddy diffusivity [m^2/s]Confidence indicator - Ceiling [non-dim]Confidence indicator - Visibility [non-dim]Confidence indicator - Flight Category [non-dim]Latitude of V wind component of velocity [deg]Longitude of V wind component of velocity [deg]Scatterometer est. U wind component [m/s]Scatterometer est. V wind component [m/s]Latitude of U wind component of velocity [deg]Longitude of U wind component of velocity [deg]Tropical Cyclone Heat Potential [J/m^2]Geometric Depth Below Sea Surface [m]Ocean Dynamic Heat Anomaly [dynamic m]Sea Surface Height Relative to Geoid [m]UV-B Downward Solar Flux [W/m^2]Clear Sky UV-B Downward Solar Flux [W/m^2]Total downward heat flux at surface [W/m^2]UV Velocity Cross Correlation [m^2/s^2]Meteorological Correlation Length Scale [m]Latitude of pressure point [deg]Longitude of pressure point [deg]Observed radar reflectivity [dbZ]Derived radar reflectivity [dbZ]Maximum/Composite radar reflectivity [dbZ]Simulated Brightness Temperature for GOES12, Channel 2 [K]Simulated Brightness Temperature for GOES12, Channel 3 [K]Simulated Brightness Temperature for GOES12, Channel 4 [K]Simulated Brightness Temperature for GOES12, Channel 5 [K]Minimum Relative Humumidity [%]Maximum Relative Humumidity [%]Planetary boundary layer regime []Simulated brightness counts for GOES12, Channel 3 [byte]Simulated brightness counts for GOES12, Channel 4 [byte]Rain precipitation rate [kg/m^2/s]Snow precipitation rate [kg/m^2/s]Freezing rain precipitation rate [kg/m^2/s]Ice pellets precipitation rate [kg/m^2/s]Relative humidity with respect to precip water [%]Ozone daily max from 1-hour ave [ppbV]Ozone daily max from 8-hour ave [ppbV]PM 2.5 daily max from 1-hour ave [ug/m^3]PM 2.5 daily max from 24-hour ave [ug/m^3]Hourly max of sim. reflect at 1km AGL [dbZ]Hourly max updraft helicity 2-5km AGL [m^2/s^2]Hourly max upward vert vel in lowest 400mb [m/s]Hourly max downward vert fel in lowest 400mb [m/s]Hourly max column graupel [kg/m^2]20% tropical cyclone storm exceedance [m]30% tropical cyclone storm exceedance [m]40% tropical cyclone storm exceedance [m]50% tropical cyclone storm exceedance [m]60% tropical cyclone storm exceedance [m]70% tropical cyclone storm exceedance [m]80% tropical cyclone storm exceedance [m]90% tropical cyclone storm exceedance [m]Difference between 2 states in total energy norm [J/kg]U of hourly max 10m wind speed [m/s]V of hourly max 10m wind speed [m/s]Mean in-cloud turbulence potential []Maximum in-cloud turbulence potential []Mean cloud air turbulence potential []Maximum cloud air turbulence potential []Cumulonimbus horizontal extent [%]Pressure at cumblonimbus base [Pa]Pressure at cumblonimbus top [Pa]Pressure at embedded cumblonimbus base [Pa]Pressure at embedded cumblonimbus top [Pa]ICAO height at cumblonimbus base [m]ICAO height at cumblonimbus top [m]ICAO height at embedded cumblonimbus base [m]ICAO height at embedded cumblonimbus top [m]Aerosol Extinction Coefficient [1/km]Aerosol Single Scatter Albedo [-]Aerosol Back Scattering [1/km/sr]Total Inorganic and Organic Nitrates [ppbV]Lumped Single-Bond Carbon Specie [ppbV]Lumped Double-Bond Carbon Species Less Ethene [ppbV]Acetaldehyde & Higher Aldehydes [ppbV]Cresol and Higher Molecular Weight Phenols [ppbV]Lumped Gaseous Organic Nitrate [ppbV]Sulfate (SO4) Particulates ≤ 2.5 μm Diameter [μg/m^3]Ammonia (NH4) Particulates ≤ 2.5 μm Diameter [μg/m^3]Nitrate (NO3) Particulates ≤ 2.5 μm Diameter [μg/m^3]Organic Particulates ≤ 2.5 μm Diameter [μg/m^3]Primarily Organic Particulates ≤ 2.5 μm Diameter [μg/m^3]Elemental Carbon Particulates ≤ 2.5 μm Diameter [μg/m^3]Water Particulates ≤ 2.5 μm Diameter [μg/m^3]Sodium Particulates ≤ 2.5 μm Diameter [μg/m^3]Chloride Particulates ≤ 2.5 μm Diameter [μg/m^3]Particulates between 2.5 and 10 μm Diameter [μg/m^3]Total Sulfate Particulates (Fine ands Coarse) [μg/m^3]Dust Particulates between 0.2 - 2.0 μm Diameter [Kg/Kg]Dust Particulates between 2.0 - 3.6 μm Diameter [Kg/Kg]Dust Particulates between 3.6 - 6.0 μm Diameter [Kg/Kg]Dust Particulates between 6.0 - 12.0 μm Diameter [Kg/Kg]Dust Particulates between 12.0 - 20.0 μm Diameter [Kg/Kg]Sea Salt Particulates between 0.2 - 1.0 μm Diameter [Kg/Kg]Sea Salt Particulates between 1.0 - 3.0 μm Diameter [Kg/Kg]Sea Salt Particulates between 3.0 - 10.0 μm Diameter [Kg/Kg]Sea Salt Particulates between 10.0 - 20.0 μm Diameter [Kg/Kg]Hydrophobic Organic Carbon [Kg/Kg]Hydrophilic Organic Carbon [Kg/Kg]Hydrophobic Black Carbon [Kg/Kg]Hydrophilic Black Carbon [Kg/Kg]DAYTIME MAX TEMP (MAX) (Kelvin) [K]DAYTIME MAX TEMP (MAX) (deg F) [F]NORMAL MAX TEMPERATURE (Kelvin) [K]NORMAL MAX TEMPERATURE (deg F) [F]DEPARTURE FROM NORMAL MAX (K) [K]DEPARTURE FROM NORMAL MAX (deg F) [F]NIGHTTIME MIN TEMP (MIN) (Kelvin) [K]NIGHTTIME MIN TEMP (MIN) (deg F) [F]NORMAL MIN TEMPERATURE (Kelvin) [K]NORMAL NIGHTTIME MIN TEMP (deg F) [F]DEPARTURE FROM NORMAL MIN (K) [K]DEPARTURE FROM NORMAL MIN (deg F) [F]DEW POINT TEMPERATURE (deg F) [F]DEW POINT DEPRESSION (deg F) [F]PROB OF 0.01 IN. OF PRECIP (PoP) [%]PROB OF QPF >= 3.00 INCHES FUTURE [%]NML REL. FREQ. OF 0.01 IN OF PCP [%]DEPARTURE FROM NML OF 0.01 POP [%]EXPECTED VALUE OF PRECIPITATION [mm]EXPECTED VALUE OF PRECIPITATION [in]CONDITIONAL EXPECTED PRECIP AMT [mm]CONDITIONAL EXPECTED PRECIP AMT [in]PROB OF SNOW AMOUNT >= 0.10 [%]PROB OF SNOW AMOUNT >= 2 INCHES [%]PROB OF SNOW AMOUNT >= 4 INCHES [%]PROB OF SNOW AMOUNT >= 6 INCHES [%]PROB OF SNOW AMOUNT >= 8 INCHES [%]BEST CATEGORY FOR SNOW AMOUNT [num]EXPECTED VALUE OF SNOW AMOUNT [mm]EXPECTED VALUE OF SNOW AMOUNT [in]INFLATED MAX WIND SPEED (knots) [kts]INFLATED WIND SPEED (meter/sec) [m/s]INFLATED WIND SPEED (knots) [kts]PROB OF MAX WIND SPEED 0-12 kts [%]PROB OF MAX WIND SPEED 13-21 kts [%]PROB OF MAX WIND SPEED 22-31 kts [%]PROB OF MAX WIND SPEED >=32 kts [%]CATEGORICAL MAX WIND SPEED [num]EXPECTED VALUE OF MAX WIND SPEED [m/s]EXPECTED VALUE OF MAX WIND SPEED [kts]PROB OF WIND DIRECTION NORTH [%]PROB OF WIND DIRECTION NORTHEAST [%]PROB OF WIND DIRECTION EAST [%]PROB OF WIND DIRECTION SOUTHEAST [%]PROB OF WIND DIRECTION SOUTH [%]PROB OF WIND DIRECTION SOUTHWEST [%]PROB OF WIND DIRECTION WEST [%]PROB OF WIND DIRECTION NORTHWEST [%]CATEGORICAL WIND DIRECTION [num]CATEGORICAL TOTAL SKY COVER [num]CATEGORICAL MEAN SKY COVER [num]PROB OF CIG HGT 1000-3000 FT [%]PROB OF CIG HGT 3100-6500 FT [%]PROB OF CIG HGT 6600-12000 FT [%]BEST CATEGORY OF CEILING HEIGHT [num]NORMAL PROB OF THUNDERSTORMS [%]COND PROB OF SEVERE WEATHER [%]UNCONDITIONAL PROB OF TORNADO [%]UNCOND PROB OF DAMAGING WIND [%]COND PROB FRZING PRECIP (INSTANT) [%]UNCND PROB FRZING PRECIP (INSTNT) [%]COND PROB FROZEN PRECIP (INSTANT) [%]UNCND PROB FROZEN PRECIP (INSTNT) [%]COND PROB LIQUID PRECIP (INSTANT) [%]UNCND PROB LIQUID PRECIP (INSTNT) [%]CATEGORICAL PRECIP TYPE (INSTANT) [num]UNCOND PROB OF FRZING PRECIP [%]COND PROB OF RAIN/SNOW MIXED [%]UNCOND PROB OF RAIN/SNOW MIXED [%]BEST CATEGORY OF PRECIP TYPE [num]POPO PRECIP OCCURRING AT AN HOUR [%]POPO PRECIP DURING A PERIOD [%]COND PROB OF CONT (STEADY) PRECIP [%]BEST CAT PRECIP CHARACTERISTIC [num]PERCENT OF POSSIBLE SUNSHINE [%]SCAN 0-3H CATEGORICAL QPF [num]SCAN 0-3H C-G LIGHTNING PROB [%]standard deviation of height [m]pseudo-adiabatic potential temperature [K]dew-point depression (or deficit) [K]parcel lifted index (to 500 hPa) [K]geopotential height anomaly [gpm]u-component (zonal) of wind [m/s]v-component (merdional) of wind [m/s]Montgomery stream function [(m**2)/(s**2)]sigma co-ordinate vertical velocity [1/s]vertical u-component shear [1/s]vertical v-component shear [1/s]direction of current [degree true]total precipitable water [kg/m**2]total cloud ice content [kg/m**2]precipitation rate [kg/((m**2)*s)]total precipitation [kg/(m**2)]large scale precipitation [kg/(m**2)]convective precipitation [kg/(m**2)]snowfall rate water equivalent [kg/((m**2)*s)]water equivalent of accumulated snow depth [kg/(m**2)]transient thermocline depth [m]main thermocline depth anomaly [m]total cloud water content [kg/m**2]best lifted index (to 500 hPa) [K]deviation of sea-level from mean [m]soil moisture content [kg/(m**2)]ice cover (1=ice, 0=no ice) [1]direction of ice drift [degree true]significant height of comb. wind waves and swell [m]direction of wind waves [degree true]significant height of wind waves [m]direction of swell [degree true]significant height of swell [m]primary wave direction [degree true]secondary wave direction [degree true]net short-wave radiation (surface) [W/(m**2)]net long-wave radiation (surface) [W/(m**2)]net short-wave radiation (top of atmosphere) [W/(m**2)]net long-wave radiation (top of atmosphere) [W/(m**2)]short-wave radiation [W/(m**2)]boundary layer dissipation [W/(m**2)]momentum flux, u component [N/(m**2)]momentum flux, v component [N/(m**2)]geopotential height (ECMF) [gpm]u-component of wind (ECMF) [m/s]v-component of wind (ECMF) [m/s]large scale precipitation (ECMF) [kg/(m**2)]convective precipitation (ECMF) [kg/(m**2)]snowfall (ECMF) [m of water equivalent]pressure reduced to MSL (ECMF) [Pa]u-component of 10m-wind (ECMF) [m/s]v-component of 10m-wind (ECMF) [m/s]2m due-point temperature (ECMF) [K]downward shortwave radiant flux density [W/m**2]upward shortwave radiant flux density [W/m**2]downward longwave radiant flux density [W/m**2]upward longwave radiant flux density [W/m**2]downwd photosynthetic active radiant flux density [W/m**2]total net radiative flux density [W/m**2]downw shortw radiant flux density, cloudfree part [W/m**2]upw shortw radiant flux density, cloudy part [W/m**2]downw longw radiant flux density, cloudfree part [W/m**2]upw longw radiant flux density, cloudy part [W/m**2]shortwave radiative heating rate [K/s]longwave radiative heating rate [K/s]total radiative heating rate [K/s]soil heat flux, surface [W/m**2]soil heat flux, bottom of layer [W/m**2]cloud cover, grid scale + convective [1]cloud cover, grid scale (0...1) [1]specific cloud water content, grid scale [kg/kg]cloud water content, grid scale, vert integrated [kg/m**2]specific cloud ice content, grid scale [kg/kg]cloud ice content, grid scale, vert integrated [kg/m**2]specific rainwater content, grid scale [kg/kg]specific snow content, grid scale [kg/kg]specific rainwater content, gs, vert. integrated [kg/m**2]specific snow content, gs, vert. integrated [kg/m**2]specific graupel content, grid scale [kg/kg]vert. integral of humidity, cloud water (and ice) [kg/(m**2)]vert. integral of divergence of tot. water content [kg/(m**2)]cloud covers CH_CM_CL (000...888) [1]cloud cover, convective cirrus (0...1) [1]specific cloud water content, convective clouds [kg/kg]cloud water content, conv clouds, vert integrated [kg/m**2]specific cloud ice content, convective clouds [kg/kg]cloud ice content, conv clouds, vert integrated [kg/m**2]convective mass flux [kg/(s*m**2)]updraft velocity, convection [m/s]entrainment parameter, convection [m**(-1)]cloud base, convective clouds (above msl) [m]cloud top, convective clouds (above msl) [m]convective layers (00...77) (BKE) [1]convective temperature tendency [K/s]convective tendency of specific humidity [s**(-1)]convective tendency of total heat [J/(kg*s)]convective tendency of total water [s**(-1)]convective momentum tendency (X-component) [m/s**2]convective momentum tendency (Y-component) [m/s**2]convective vorticity tendency [s**(-2)]convective divergence tendency [s**(-2)]top of dry convection (above msl) [m]height of 0 degree Celsius isotherm above msl [m]height of snowfall limit above msl [m]spec water cont of rain/snow needed for w loading [kg/kg]surface precipitation rate, rain, grid scale [kg/(s*m**2)]surface precipitation rate, snow, grid scale [kg/(s*m**2)]surface precipitation amount, rain, grid scale [kg/m**2]condensation rate, grid scale [kg/(kg*s)]autoconversion rate, grid scale (C+C --> R) [kg/(kg*s)]accretion rate, grid scale (R+C --> R) [kg/(kg*s)]nucleation rate, grid scale (C+C --> S) [kg/(kg*s)]riming rate, grid scale (S+C --> S) [kg/(kg*s)]deposition rate, grid scale (S+V <--> S) [kg/(kg*s)]melting rate, grid scale (S --> R) [kg/(kg*s)]evaporation rate, grid scale (R+V <-- R) [kg/(kg*s)]surface precipitation rate, rain, convective [kg/(s*m**2)]surface precipitation rate, snow, convective [kg/(s*m**2)]surface precipitation amount, rain, convective [kg/m**2]condensation rate, convective [kg/(kg*s)]autoconversion rate, convective [kg/(kg*s)]accretion rate, convective [kg/(kg*s)]nucleation rate, convective [kg/(kg*s)]riming rate, convective [kg/(kg*s)]sublimation rate, convective [kg/(kg*s)]melting rate, convective [kg/(kg*s)]evaporation rate, convective [kg/(kg*s)]rain amount, grid-scale plus convective [kg/m**2]snow amount, grid-scale plus convective [kg/m**2]temperature tendency, grid-scale condensation [K/s]tendency of specific humidity, grid-scale condens [s**(-1)]tendency of total heat, grid-scale condensation [J/(kg*s)]tendency of total water, grid-scale condensation [s**(-1)]tend of the sp cl ice cont due to gs precipitation [kg/(kg*s)]surface precipitation rate, graupel, grid scale [kg/(s*m**2)]surface precipitation amount, graupel, grid scale [kg/(m**2)]deviation of pressure from reference value [Pa]kinetic energy ((u**2 + v**2) / 2) [(m**2/s**2)]coefficient of horizontal diffusion [m**2/s]turbulent kinetic energy [(m/s)**2]coefficient of vertical diffusion, momentum [m**2/s]coefficient of vertical diffusion, heat [m**2/s]coefficient of vertical diffusion, cloud water [m**2/s]coefficient of vertical diffusion, cloud ice [m**2/s]coefficient of vertical diffusion, water vapour [m**2/s]turbulent dissipation length for momentum [m]turbulent dissipation length for heat [m]variance of u-component of momentum [(m/s)**2]variance of v-component of momentum [(m/s)**2]variance of w-component of momentum [(m/s)**2]variance of specific cloud water content [(kg/kg)**2]variance of specific cloud ice content [(kg/kg)**2]variance of water vapour mixing ratio [(kg/kg)**2]turbulent vertical flux of spec cloud water [m/s]turbulent vertical flux of spec cloud ice [m/s]turbulent vertical flux of water vapour mix ratio [m/s]transfer coefficient CH (sensible heat) [1]transfer coefficient CQ (latent heat) [1]temperature jump at PBL-top [K]specific humidity jump at PBL-top [kg/kg]entrainment at PBL-top [kg/(s*m**2)]upward mass flux at PBL-top [kg/(s*m**2)]cloud cover of PBL-clouds (0...1) [1]specific cloud water content of PBL-clouds [kg/kg]mountain wave momentum flux divergence (X comp) [m/s**2]mountain wave momentum flux divergence (Y comp) [m/s**2]mountain wave dissipation, vert integrated [W/m**2]vertical wave energy flux [kg*m/s**4]water + ice content of soil layers [kg/(m**2)]ice content of soil layers [kg/(m**2)]water content of interception store [kg/(m**2)]icebit for interception store [1]interception store evaporation [m/s]evaporation from water surfaces [m/s]total evaporation (water, soil, plants) [m/s]maximum wind velocity (modified) [m/s]effective transmissivity of solar rad. [1]cloud base mass flux kg/(s*m**2)convective available potential energy [J/kg]moisture convergence for Kuo-type closure [1/s]convective turbulent energy [J/kg]MOS Gewitter-Wahrscheinlichkeit (frequent) [1]MOS Gewitteranteil (occasional - frequent (1 - 2)) [1]MOS Wahrscheinlichkeit mindestens ein Blitz [1]MOS Wahrscheinlichkeit mindestens zehn Blitze [1]MOS Wahrscheinlichkeit mindestens hundert Blitze [1]MOS Vorhersage der Blitzanzahl [1]MOS Gewitter-Wahrscheinlichkeit (occasional) [1]Seegang direction [degree true]Seegang energy densitiy [(m**2)*(s**2)]Varianz Geopotential [(m/s)**4]Varianz Meridionalwind [(m/s)**2]Varianz spezifische Feuchte [(kg/kg)**2]Meridionaler Impulstransport [(m/s)**2]Meridionaler Transport potentieller Energie [(m/s)**3]Meridionaler Transport sensibler Waerme [K*(m/s)]Meridionaler Transport latenter Waerme [(kg/kg)*(m/s)]Vertikaler Transport potentieller Energie [(m/s)**2*(Pa/s)]Vertikaler Transport sensibler Waerme [K*(Pa/s)]Vertikaler Transport latenter Waerme [(kg/kg)*(Pa/s)]Varianz des Analyse-Fehlers Geopotential [(m/s)**4]Varianz des Analyse-Fehlers Zonalwind [(m/s)**2]Varianz des Analyse-Fehlers Meridionalwind [(m/s)**2]standard deviation of subgrid scale orogr. height [m]angle betw. principal axis of orogr. and global E [1]mean slope of subgrid scale orography [1]subgrid-scale variance of orography [m**2]E-W component of subgrid-scale variance of orogr [m**2]N-S component of subgrid-scale variance of orogr [m**2]NW-SE component of subgrid-scale variance of orogr [m**2]NE-SW component of subgrid-scale variance of orogr [m**2]height of maximum of ozone concentration [Pa]total vertically integrated ozone content [Pa]ground fraction covered by plants (vegetation p.) [1]ground fraction covered by plants (time of rest) [1]leaf area index (vegetation period) [1]leaf area index (time of rest) [1]Orographie + Land-Meer-Verteilung [m]variance of soil moisture content [kg**2/m**4]ground fraction covered by evergreen forest [1]ground fraction covered by deciduous forest [1]normalized differential vegetation index [1]annual max. of norm. differential vegetation index [1]proportion of act.value/max. norm.diff.veg.index [1]aerosol optical depth, type sea [1]aerosol optical depth, type land [1]aerosol optical depth, type urban [1]aerosol optical depth, type desert [1]sum of diabatic heating terms [K/s]non-advective tendency of specific humidity [s**(-1)]advective momentum tendency (X component) [m/s**2]non-advective momentum tendency (X component) [m/s**2]non-advective momentum tendency (Y component) [m/s**2]sum of mountain and frictional torque [kg*(m/s)**2]relaxation factor (lateral boundary, LAM) [1]climatic sea surface temp interpolated in time [degr C]potential vorticity [K*m**2/(s*kg)]delay of the GPS signal through the atmosphere [m]delay of the GPS signal through a wet atmosphere [m]delay of the GPS signal through a dry atmosphere [m]SO2-concentration [10**(-6)*g/m**3]SO2-dry deposition [10**(-3)*g/m**2]SO2-wet deposition [10**(-3)*g/m**2]SO4-concentration [10**(-6)*g/m**3]SO4-dry deposition [10**(-3)*g/m**2]SO4-wet deposition [10**(-3)*g/m**2]NO-concentration [10**(-6)*g/m**3]NO-dry deposition [10**(-3)*g/m**2]NO-wet deposition [10**(-3)*g/m**2]NO2-concentration [10**(-6)*g/m**3]NO2-dry deposition [10**(-3)*g/m**2]NO2-wet deposition [10**(-3)*g/m**2]NO3-concentration [10**(-6)*g/m**3]NO3-dry deposition [10**(-3)*g/m**2]NO3-wet deposition [10**(-3)*g/m**2]HNO3-concentration [10**(-6)*g/m**3]HNO3-dry deposition [10**(-3)*g/m**2]HNO3-wet deposition [10**(-3)*g/m**2]NH3-concentration [10**(-6)*g/m**3]NH3-dry deposition [10**(-3)*g/m**2]NH3-wet deposition [10**(-3)*g/m**2]NH4-concentration [10**(-6)*g/m**3]NH4-dry deposition [10**(-3)*g/m**2]NH4-wet deposition [10**(-3)*g/m**2]O3-concentration [10**(-6)*g/m**3]PAN-concentration [10**(-6)*g/m**3]PAN-dry deposition [10**(-3)*g/m**2]OH-concentration [10**(-6)*g/m**3]O3-dry deposition [10**(-3)*g/m**2]O3-wet deposition [10**(-3)*g/m**2]Mom. flux, u component, due to SSO-effects [(N/(m**2)]Mom. flux, v component, due to SSO-effects [(N/(m**2)]Dissipation of kinetic energy due to SSO-effects [(W/(m**2)]UV_Index corr. for albedo+altitude,cloudless(F), h [1]Basic UV_Index m.s.l.,fixed albedo,cloudless(F), h [1]UV_Index corrected for albedo+altitude+clouds(W),h [1]UV_Index cloudless (F), daily maximum [1]Sonnenbrand-Index [(W*10**(-3))/m**2]total column ozone (Gesamtozon) [Dobson Unit, DU]UV_Index clouded (W), daily maximum [1]time of UV_Index maximum [h UTC]dew-point temperature [1*degree Celsius]wind components X/Y (X*100000 + ((Y*10)+5000)) [m/s]wind direction and speed (dd*1000 + ff) [1*degree, 1*kt]3 hour pressure change [Pa/(3*h)]wind direction and speed (dd*1000 + ff) [5*degrees, 1*(m/s)]wind direction and speed (dd*1000 + ff) [5*degrees, 1*kt]direction and height of swell (dd*1000 + h) [1*degree, 1*cm]wind component X-direction [kt]wind component Y-direction [kt]absolute vorticity advection [1/(s**2)]maximum temperature [1*degree Celsius]minimum temperature [1*degree Celsius]probability to perceive sultriness [1]value of isolation of clothes [1]predected mean vote (angepasst) [1]feeled temperature [1*degree Celsius]sea temperature [1*degree Celsius]Summe der Globalstrahlung ueber einen Zeitraum [kWh/m**2]Niederschlagsart+Gewitter+Glatteis (T23-i) (0..99) [1]Niederschlagsart+Gewitter (T23-intern) (0..99) [1]Niederschlagsart+Glatteis (T23-intern) (0..99) [1]Kombination Niederschl.-Bew.-Blautherm. (283..407) [1]Hoehe der Konvektionsuntergrenze ueber Grund [m]Niederschlagsart -ww- (T23-intern) (0..99) [1]Konvektionsart (0..4) [1]Hoehe der Konvektionsuntergrenze ueber nn [m]Wetter (verschluesselt nach ww-Tabellegeostrophische Vorticityadvektion [1/s**2]vert. Gradient der geostr. Vorticityadvektion [m/(kg*s)]geostrophische Schichtdickenadvektion [m**3/(kg*s)]Kruemmung der geostr. Schichtdickenadvektion [m/(kg*s)]Forcing rechte Seite Omegagleichung [m/(kg*s)]Schichtdicken-Advektion [m**3/(kg*s)]Advektion von geostr. Vorticity mit dem therm Wind [m/(kg*s)]Q-Vektor X-Komponente [m**2/(kg*s)]Q-Vektor Y-Komponente [m**2/(kg*s)]Divergenz Qn geostrophisch [m/(kg*s)]Divergenz Qs geostrophisch [m/(kg*s)]Frontogenesefunktion [K**2/(m**2*s)]Qs, Komp. Q-Vektor parallel zu den Isothermen [m**2/(kg*s)]Isentrope potentielle Vorticity [K*m**2/(s*kg)]Wind X-Komponente auf isentropen Flaechen [m/s]Wind Y-Komponente auf isentropen Flaechen [m/s]Druck einer isentropen Flaeche [hPa]Clear Air Turbulence Index [1/s]Pseudopotentielle Temperatur [K]Aequivalentpotentielle Temperatur [K]Untergrenze strat. Bew|lkung [hft]Untergrenze strat. Bew|lkung [hPa]Untergrenze cumul. Bew|lkung [hft]Untergrenze cumul. Bew|lkung [hPa]Obergrenze strat. Bew|lkung [hft]Obergrenze strat. Bew|lkung [hPa]Obergrenze cumul. Bew|lkung [hft]Obergrenze cumul. Bew|lkung [hPa]Untergrenze Wolkenturbulenz [hft]Untergrenze Wolkenturbulenz [hPa]Obergrenze Wolkenturbulenz [hft]Obergrenze Wolkenturbulenz [hPa]Untergrenze Vereisung in Wolken [hft]Untergrenze Vereisung in Wolken [hPa]Obergrenze Vereisung in Wolken [hft]Obergrenze Vereisung in Wolken [hPa]Intensitaet der Turbulenz in Wolken (0..4) [1]Intensitaet der Vereisung (0..4) [1]Icing Regime 1.Guess(1=gen,2=conv,3=strat,4=freez) [1]Icing Grade (1=LGT,2=MOD,3=SEV) [1]Icing Regime(1=general,2=convect,3=strat,4=freez) [1]Wetter - 1. lokale Abweichung (wwWetter - 2. lokale Abweichung (wwmodified total cloud cover (0..1) [1]Gesamtbedeckung > 90% ja/nein [1]relative Feuchte 700 hPa >= 90% ja/nein [1]Niederschlag 12 std. zentriert [mm]Niederschlag 12 std. zentriert, Werte <= 0.5mm [mm]RR12 zentriert, Schneeanteil > 60% ja/nein [1]RR12 zentriert, konvektiver Anteil > 60% ja/nein [1]Starkniederschlag in Stufen (12 std. Folgezeitr) [1]Maximaler Starkniederschlag / std [mm/h]Maximaler Starkniederschlag / min [mm/min]Schneefall (12std. Folgezeitraum) > 15 mm ja/nein [1]gefrierender Regen (12std. Folgezeitraum) ja/nein [1]2m Maximumtemperatur 12h zentriert [Grad Celsius]2m Minimumtemperatur 12h zentriert [Grad Celsius]Obergrenze Smog ( Inversionshoehe ) [m]pressure RMS-error first guess - analysis [Pa]pressure RMS-error initialised analysis - analysis [Pa]u RMS-error first guess - analysis [m/s]u RMS-error initialised analysis - analysis [m/s]v RMS-error first guess - analysis [m/s]v RMS-error initialised analysis - analysis [m/s]geopotential RMS-error first guess - analysis [(m**2)/(s**2)]relative humidity RMS-error first guess - analysis [1]rel. hum. RMS-error init. analysis - analysis [1]temperature RMS-error first guess - analysis [K]temperature RMS-error init. analysis - analysis [K]omega RMS-error first guess - analysis [m/s]omega RMS-error initialised analysis - analysis [m/s]kinetic energy RMS-error init. analysis [(m**2)/(s**2)]probability of total precipitation > 20mm [1]probability of total precipitation > 50mm [1]probability of total precipitation > 100mm [1]probability of maximum wind speed > 10m/s [1]probability of maximum wind speed > 15m/s [1]probability of maximum wind speed > 20m/s [1]METEOSAT-5 mit Instrument MVIRI [1]METEOSAT-6 mit Instrument MVIRI [1]METEOSAT-7 mit Instrument MVIRI [1]PSEUDO-ADIABATIC POTENTIAL TEMPERATURE [K]ABSOLUTE VORTICITY [10**5/sec]ABSOLUTE DIVERGENCE [10**5/sec]INST. PRECIPITABLE WATER [Kg/m2]SATURATION DEFICIT [Pa hPa]PRECIPITATION RATE [kg/m2/day]TOTAL PRECIPITATION [Kg/m2/day]LARGE SCALE PRECIPITATION [Kg/m2/day]CONVECTIVE PRECIPITATION [Kg/m2/day]WAT EQUIV ACC SNOW DEPTH [kg/m2]MEDIUM CLOUD COVER [0-1]BEST LIFTED INDEX (TO 500 HPA) [K]SPEED OF ICE DRIFT [m/s]SHORT WAVE ABSORBED AT GROUND [W/m2]OUTGOING LONG WAVE AT TOP [W/m2]SHORT WAVE ABSORBED BY EARTH/ATMOSPHERE [W/m2]LATENT HEAT FLUX FROM SURFACE [W/m2]SENSIBLE HEAT FLUX FROM SURFACE [W/m2]2 METRE DEWPOINT TEMPERATURE [K]10 METRE U-WIND COMPONENT [m/s]10 METRE V-WIND COMPONENT [m/s]GEOMETRIC MEAN SURFACE PRESSURE [hPa]M S L PRESSURE (MESINGER METHOD) [hPa]CONVECTIVE AVAIL. POT.ENERGY [m2/s2]CONVECTIVE INHIB. ENERGY [m2/s2]CONVECTIVE LATENT HEATING [K/s]CONVECTIVE MOISTURE SOURCE [1/s]SHALLOW CONV. MOISTURE SOURCE [1/s]SHALLOW CONVECTIVE HEATING [K/s]FREEZING LEVEL RELATIVE HUMIDITY [%]TROPOPAUSE U-WIND COMPONENT [m/s]TROPOPAUSE v-WIND COMPONENT [m/s]GRAVITY WAVE DRAG SFC ZONAL STRESS [Pa]GRAVITY WAVE DRAG SFC MERIDIONAL STRESS [Pa]DIVERGENCE OF SPECIFIC HUMIDITY [1/s]HORIZ. MOISTURE FLUX CONV. [1/s]VERT. INTEGRATED MOISTURE FLUX CONV. [kg/(m2*s)]VERTICAL MOISTURE ADVECTION [kg/(kg*s)]NEG. HUM. CORR. MOISTURE SOURCE [kg/(kg*s)]LARGE SCALE LATENT HEATING [K/s]LARGE SCALE MOISTURE SOURCE [1/s]SOIL MOISTURE AVAILABILITY [0-1]SOIL TEMPERATURE OF ROOT ZONE [K]VAPOR PRESSURE OF CANOPY AIR SPACE [mb]SURFACE SPEC HUMIDITY [kg/kg]SOIL WETNESS OF ROOT ZONE [0-1]SOIL WETNESS OF DRAINAGE ZONE [0-1]SURFACE ABSOLUTE TEMPERATURE [K]TEMPERATURE OF CANOPY AIR SPACE [K]GROUND/SURFACE COVER TEMPERATURE [K]SURFACE MERIDIONAL WIND (V) [m/s]SURFACE MERIDIONAL WIND STRESS [Pa]INCIDENT SHORT WAVE FLUX [W/m2]TIME AVE GROUND HT FLX [W/m2]NET LONG WAVE AT BOTTOM (CLEAR) [W/m2]OUTGOING LONG WAVE AT TOP (CLEAR) [W/m2]SHORT WV ABSRBD BY EARTH/ATMOS (CLEAR) [W/m2]SHORT WAVE ABSORBED AT GROUND (CLEAR) [W/m2]LONG WAVE RADIATIVE HEATING [K/s]SHORT WAVE RADIATIVE HEATING [K/s]DOWNWARD LONG WAVE AT BOTTOM [W/m2]DOWNWARD LONG WAVE AT BOTTOM (CLEAR) [W/m2]DOWNWARD SHORT WAVE AT GROUND [W/m2]DOWNWARD SHORT WAVE AT GROUND (CLEAR) [W/m2]UPWARD LONG WAVE AT BOTTOM [W/m2]UPWARD SHORT WAVE AT GROUND [W/m2]UPWARD SHORT WAVE AT GROUND (CLEAR) [W/m2]UPWARD SHORT WAVE AT TOP [W/m2]UPWARD SHORT WAVE AT TOP (CLEAR) [W/m2]HORIZONTAL HEATING DIFFUSION [K/s]HORIZONTAL MOISTURE DIFFUSION [1/s]HORIZONTAL DIVERGENCE DIFFUSION [1/s2]HORIZONTAL VORTICITY DIFFUSION [1/s2]VERTICAL DIFF. MOISTURE SOURCE [1/s]VERTICAL DIFFUSION DU/DT [m/s2]VERTICAL DIFFUSION DV/DT [m/s2]VERTICAL DIFFUSION HEATING [K/s]SURFACE RELATIVE HUMIDITY [no Dim]VERTICAL DIST TOTAL CLOUD COVER [no Dim]TIME MEAN SURFACE ZONAL WIND (U) [m/s]TIME MEAN SURFACE MERIDIONAL WIND (V) [m/s]TIME MEAN SURFACE ABSOLUTE TEMPERATURE [K]TIME MEAN SURFACE RELATIVE HUMIDITY [no Dim]TIME MEAN ABSOLUTE TEMPERATURE [K]TIME MEAN DEEP SOIL TEMPERATURE [K]TIME MEAN GEOPOTENTIAL HEIGHT [m]TIME MEAN LOG SURFACE PRESSURE [ln(cbar)]TIME MEAN MERIDIONAL WIND (V) [m/s]TIME MEAN POTENTIAL TEMPERATURE [K]TIME MEAN PRECIP. WATER [kg/m2]TIME MEAN RELATIVE HUMIDITY [%]TIME MEAN SEA LEVEL PRESSURE [hPa]TIME MEAN SPECIFIC HUMIDITY [kg/kg]TIME MEAN STREAM FUNCTION| m2/s]TIME MEAN SURFACE PRESSURE [hPa]TIME MEAN SURFACE TEMPERATURE [K]TIME MEAN VELOCITY POTENTIAL [m2/s]TIME MEAN VIRTUAL TEMPERATURE [K]Potential vorticity [K*m^2/kg/s]Large scale precipitation [mm/day]Convective precipitation [mm/day]Snowfall rate water equivalent [mm/day]Water equivalent of accumulated snow depth [kg/m^2]Land cover (1 = land, 0 = sea) [Proportion]Ice cover (1 = ice, 0 = no ice) [Proportion]Momentum flux, u-component [N/m^2]Momentum flux, v-component [N/m^2]Square of Brunt-Vaisala frequency [1/s^2]Zonal momentum flux by long gravity wave [N/m^2]Meridional momentum flux by long gravity wave [N/m^2]Adiabatic zonal acceleration [m/s/day]Meridional water vapour flux [Kg/m/s]Meridional momentum flux by short gravity wave [N/m^2]Zonal water vapour flux [kg/m/s]Zonal momentum flux by short gravity wave [N/m^2]Clear sky upward solar radiation flux [W/m^2]Clear sky downward solar radiation flux [W/m^2]Clear sky upward long wave radiation flux [W/m^2]Clear sky downward long wave radiation flux [W/m^2]Adiabatic meridional acceleration [m/s/day]Frequency of deep convection [%]Frequency of shallow convection [%]Frequency of stratocumulus parameterisation [%]Gravity wave zonal acceleration [m/s/day]Gravity wave meridional acceleration [m/s/day]Zonal thermal energy flux [W/m]Meridional thermal energy flux [W/m]Downward long wave radiation flux [W/m^2]Moisture storage on ground/cover [m]Mass concentration of condensed water in soil [kg/m^3]Upward mass flux at cloud base [kg/m^2/s]Adiabatic moistening rate [kg/kg/day]Convective zonal acceleration [m/s/day]Convective meridional acceleration [m/s/day]Large scale condensation heating rate [K/day]Convective heating rate [k/day]Convective moistening rate [kg/kg/day]Vertical diffusion heating rate [K/day]Vertical diffusion zonal acceleration [m/s/day]Vertical diffusion meridional acceleration [m/s/day]Vertical diffusion moistening rate [kg/kg/day]Solar radiative heating rate [k/day]Long wave radiative heating rate [K/day]Large scale moistening rate [kg/kg/day]j@j@j@j@uj@gj@Yj@Kj@=j@/j@j@Af@'f@ f@j@j@j@j@j@ j@j@i@i@i@j@j@j@j@j@j@j@i@i@i@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@j@i@vi@ei@Ti@AB>AA$>A AtA,B,>APB0>A4>A@>AH>Ah>Ap>A>AtB>AB>AB>A B>ADB>ApB>AB>AB>AB>A$B>ATB>AB>AB>AB>AB?A@B ?AtB?AB?AB ?AB(?A,?AD?AHBL?AtBT?AB\?AB`?ABd?A$Bl?Ap?A?A?A?A?A?A?A?AXB?AB@AB@AB@A @A(@A,@AL@A BT@AH B\@Ap BkAd@A|@A B@A@A@A B@A B@A!B@A@!BhA@AAlA3A3A A B3A3A4A B 4A4 B@AlA@AlA@AlA@AlA@AlA4Ad B4A B4A B4A BAAlAAAlAAAlAAAlA AAlA(AAlA5A B 5AD B(5A BA B05A BHA85AP5AT5At5A Bx5A|5A5A5A5A5A5A5A5A5A 6A6A06A B86A B@6AD BH6Ah BP6A BX6A B`6A Bh6ABp6At6A6A6A6A6A6A6A6A<B6A`B6A6A7AB$7Ap!B,7A!B47A BAA<7A!BH7A|BP7ABT7ABA(BA\B0AAA`7Ah7A7AB7AB7AB7AB7A8B7AhB7AB7AB7AB4AAlAAB>AA$>A AtA,B,>APB0>A4>A@>AH>Ah>Ap>A>AtB>AB>AB>A B>ADB)AlA>AB>AB>AB>A$B>ATB>AB>AB>AB>AB?A@B ?AtB?AB?AB ?AB(?A,?AD?AHBL?AtBT?AB\?Ad"B`?ABd?A$Bl?Ap?A?A?A?A?A?A?A?AXB?AB@AB@AB@A @A(@A,@AL@A BT@AH B\@Ap BkAd@A|@A B@A@A@A B@A B@A!B@A@!BhA@AAlAAAlAAAlAAAlApAlAxAlA@AlA@AlA@AlA@AlA@AlAAAlAAAlAAAlAAAlAAAlAAAlAAAlAAAlA AAlA(AAlAAAlAAAlAAAlAAlA05AlAAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlA`BAlAhBAlApBAlAxBAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlAX7AlABAlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA4AAlAAD#B>Al#B>A#B>A#B>A $B>A<$B>Ap$B>A$B>A$B?A$B ?A,%B?A`%B?AA ?A%BCA%BCA&BCA8&BCAh&BCA&B)AlA3AlA.AlA"AlA*AlA/AlA3AlA/AlA/AlA /AlA(/AlA0/AlA,*AlA8/AlA@/AlAH/AlAP/AlA4*AlA<*AlAX/AlA`/AlAh/AlAhA@AAlACA&BDA&BDA'BDAD'BDAp'B DA'B(DA'B0DA(B8DA8(B@DAh(BAAlAAAlAAAlAAAlAHDA(BPDA(BXDA )B`DA8)B AAlAhDA`)BpDA)BxDA)BDA)BDA*BDA0*BAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlA`BAlAhBAlApBAlAxBAlABAlADA\*BBAlABAlABAlABAlABAlABAlABAlABAlABAlADA*BDA*BDA*BDA +BDAL+BDAx+BDA+BDA+BDA,BDAH,BDA,BDA,BEA,BEA(-BEA`-BEA-B EA-B(EA-B0EA.B8EA<.B@EAd.BHEA.BPEA.BXEA.B`EA/BhEA4/BpEA`/BxEA/BEA/BEA/Bh8AlAp8AlAx8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA9AlA9AlA9AlA9AlA 9AlA(9AlA09AlA89AlA@9AlAH9AlAAlAAlAAlABAlABAlACAlAlAAlAp9AlAx9AlACAlA,'AlAEAEAEA0B<'AlAD'AlA0#AlAL'AlAT'AlA\'AlAd'AlAH#AlAl'A@0Bt'AlA|'AlA'AlA'AlAEAd0Bt*AlA|*AlA*AlA*AlA*AlAhAlApA0BxAlA*AlAAlA*AlA*AlA*AlA*AlA*AlA*AlA*AlA+AlA+AlAEA0BEA0B|1AlAEA1B1AlA1AlA+AlA+AlA,AlA$(AlA,(AlA4(AlACAlA CAlA(CAlA0CAlA,AlA8CAlA@CAlAHCAlAPCAlA0%AlA8%AlA,AlAXCAlA,AlA,AlA43AlA`CAlAhCAlA4-AlA%AlApCAlA)AlAp-AlAx-AlA-AlAEA01BEAh1B3AlA3AlA3AlA3AlA-AlA-AlA%AlA,.AlA4.AlA<.AlA)AlA)AlA%AlA)AlA%AlA)AlA3AlA3AlAT.AlA\.AlAd.AlAl.AlAt.AlA|.AlA.AlAEA1BEA1B.AlA.AlAEA2B)AlA3AlA.AlA"AlA*AlA/AlA3AlA/AlA/AlA /AlA(/AlA0/AlA,*AlA8/AlA@/AlAH/AlAP/AlA4*AlA<*AlAX/AlA`/AlAh/AlAhA@AAlAAAlAAAlAAAlApAlAxAlA@AlA@AlA@AlA@AlA@AlAAAlAAAlAAAlAAAlAAAlAAAlAAAlAAAlA AAlA(AAlAAAlAAAlAAAlAAlA05AlAAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlA`BAlAhBAlApBAlAxBAlABAlAEA02BBAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlAX7AlABAlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA4AAlABGAH>BHA|>BHA>BHA>BHA?B HAL?B(HA?B0HA?B8HA?B@HA@BHHAP@BPHA@BXHA@B`HA@BhHA ABpHATABxHAABHAABHAABHA$BBHAXBBHABBHABBHABBHA(CBHA\CBHACBHACBHACBHA,DBHA`DBHADBHADBIADBIA0EBIAdEBIAEB IAEB(IAFB0IA4FB8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA8AlA9AlA9AlA9AlA9AlA 9AlA(9AlA09AlA89AlA@9AlAH9AlAAlAAlAAlABAlABAlACAlAlAAlAp9AlAx9AlACAlA,'AlA(#AlA4'AlA<'AlAD'AlA0#AlAL'AlAT'AlA\'AlAd'AlAH#AlAl'AlAt'AlA|'AlA'AlA'AlAl*AlAt*AlA|*AlA*AlA*AlA*AlAhAlApAlAxAlA*AlAAlA*AlA*AlA*AlA*AlA*AlA*AlA*AlA+AlA+AlAl1AlACAlA|1AlA1AlA1AlA1AlA+AlA+AlA,AlA$(AlA,(AlA4(AlACAlA CAlA(CAlA0CAlA,AlA8CAlA@CAlAHCAlAPCAlA0%AlA8%AlA,AlAXCAlA,AlA,AlA43AlA`CAlAhCAlA4-AlA%AlApCAlA)AlAp-AlAx-AlA-AlA%AlA3AlA3AlA3AlA3AlA3AlA-AlA-AlA%AlA,.AlA4.AlA<.AlA)AlA)AlA%AlA)AlA%AlA)AlA3AlA3AlAT.AlA\.AlAd.AlAl.AlAt.AlA|.AlA.AlA.AlA.AlA.AlA.AlA)AlA)AlA3AlA.AlA"AlA*AlA/AlA3AlA/AlA/AlA /AlA(/AlA0/AlA,*AlA8/AlA@/AlAH/AlAP/AlA4*AlA<*AlAX/AlA`/AlAh/AlAhAlAAlAAAlAAAlAAAlApAlAxAlA@AlA@AlA@AlA@AlA@AlAAAlAAAlAAAlAAAlAAAlAAAlAAAlAAAlA AAlA(AAlAAAlAAAlAAAlAAlA05AlAAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlA`BAlAhBAlApBAlAxBAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlAX7AlABAlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA4AAlAAJAJAJApJBJAJBJAJBKAJBKAKBKAKA0KA4KALKA@KBhA@AAlAAAlAAAlAAAlApAlAxAlA@AlA@AlA@AlA@AlA@AlAAAlAAAlAAAlAAAlAAAlAAAlAAAlAAAlA AAlA(AAlAAAlAAAlAAAlAAlA05AlAAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlA`BAlAhBAlApBAlAxBAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlAX7AlABAlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA4AAlAAB>AUB$>A$VB3AlA,>APB0>ARARA`VBRAVBRAVBRAVBRA4WBRAhWBRAWB4NAWBRA XBtNAHXBRAtXBTNAXBRAXBRA YBfAXYBRAYBRAYBRAYBRA4ZBRAlZBRAZB.AlA(?A,?AD?AHBL?AtBT?AB\?AB`?ABd?A$Bl?Ap?A?A?A?A?A?A?A?AZB?A[BRAH BkAd@A@ARA(@A,@AL@A BX^Ap>ASA SAH/AlAP/A([B4*AlA<*AlAX/AlA`/AlA$SAP[BhA@AAlAAAlAAAlAAAlApAlAxAlA@AlA@AlA@AlA@AlA@AlAAAlAAAlAAAlAAAlAAAlAAAlAAAlAAAlA AAlA(AAlAAAlAAAlAAAlAAlA05AlAAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlA`BAlAhBAlApBAlAxBAlABAlABAlABAlABAt[BBA0:ABA[BBA[BBA[BBAABA ABA8\BBAl\BBA\BX7A\BBA]B7A4]B7A`]B7A]B7A]B7A ^B7AH^B7A^B7A^B7A`A4AAAA!B$>A"B3AlA3AlA3AlA3AlA-AlA-AlA%AlA,.AlA4.AlA<.AlA)AlA)AlA%AlA)AlA%AlA)AlA3AlA3AlAT.AlA\.AlAd.AlAl.AlAt.AlA|.AlA.AlA(?A,?A.AlA.AlA.AlA)AlA)AlA3AlA.AlA"AlA*AlA/AlA3AlA/AlA/AlA /AlA(/AlA0/AlA,*AlA8/AlA@/AlAH/AlAP/AlA4*AlA<*AlAX/AlA`/AlAh/AlAhA@AAlASAdhBSAhBAA3ApA BxA4 B@AlA@AlA@AlA@AlA@AlAAAd BAA BAA BAA BAAlAAAlAAAlAAAlA AAlA(AAlAAA BAAD BAA BAlA05AlAAA85AAAT5AAA BAA|5AAA5AAA5ABA5ABA5ABA6ABA B BA B(BAD B0BAh B8BA B@BA BHBA BPBABXBAt6A`BA6AhBA6ApBA6AxBA<BBA`BBA6ABABBAp!BBA!BBA BBAABA!BBA|BBAhBBAhBBA(BBA\BX7AABAh7A7AB7AB7AB7AlA7AlA7AlA7AlA7AlA7AlA4AAlAA3AH>A-Ap>A-AtB%AB,.AB4.A B<.ATA)AlA)AB%AB)AB%AjB)ATB3AB3ABT.AB\.ABd.A@Bl.AtBt.AB|.AB.ABTAjB.AHB.AtB.AB)Ad"B)AB3A$B.Ap?A"A?A*A?A/A?A3AXB/AB/AB /AB(/A @A0/A,@A,*A B8/AH B@/Ap BH/Ad@AP/A B4*A@A<*A BX/A B`/A!Bh/A@!BhA@AAlAAAlAAAlAAAlApAlAxAlA@AlA@AlA@AlA@AlA@AlAAAlAAAlAAAlAAAlAAAlAAAlAAAlAAAlA AAlA(AAlAAAlAAAlAAAlAAlA05AlAAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlATAkBTATApBAlAxBAlATA8kBBAlA$@\kBBAlABAlABAlABAlABAlABAlABAlABAlABAlABAlAX7AlABAlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA4AAlAAUA3AlA-AlA>A nB>A8nB>AhnB>AnBXAUA)AlA)AlA%AlA)AlA%AlA)AlA3AlA3AlAT.AlA\.AlAd.AlAl.AlAt.AlA|.AlA.AlA(?AUA.AlA.AlA.AlA)AlA)AlA3AlA.AlA"AlA*AlA/AlA?AnB?AnB/AlA /AlA(/AlA0/AlA,*AlA8/AlA@/AlAH/AlAP/AlA4*AlA<*AlAX/AlA`/AlAh/AlAhAlAAlAAAlAAAlAAAlApAlAxAlA@AlA@AlA@AlA@AlA@AlAAAlAAAlAAAlAAAlAAAlAAAlAAAlAAAlA AAlA(AAlAAAlAAAlAAAlAAlA05AlAAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlA`BA0oBhBA\oBpBAlAxBAlABAoBBAlABAoBBAlABAlABAlABAlABAlABAlABAlABAlABAlABAlAX7AlABAlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA4AAlAA4>A3AlA-AlA-AlA%AlA,.AlA4.AlA<.AlA)AlA)AlA%AlA)AlA%AlA)AlA3AlA3AlAT.AlA\.AlAd.AlAl.AlAt.AlA|.AlA.AlA.AlA.AlA.AlA.AlA)AlA)AlA3AlA.AlA"AlA*AlA/AlA3AlA/AlA/AlA /AlA(/AlA0/AlA,*AlA8/AlA@/AlAH/AlAP/AlA4*AlA<*AlAX/AlA`/AlAh/AlAhA@AAlAAAlAAAlAAAlApAlAxAlA@AlA@AlA@AlA@AlA@AlAAAlAAAlAAAlAAAlAAAlAAAlAAAlAAAlA AAlA(AAlAAAlAAAlAAAlAAlA05AlAAAlAAAlAAAlAAAlAAAlAAAlABAlABAlABAlABAlA BAlA(BAlA0BAlA8BAlA@BAlAHBAlAPBAlAXBAlA`BAlAhBAlApBAlAxBAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlABAlAX7AlABAlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA7AlA4AAlAAp!B$>A!B3AlA3AlA3AlA3AlA-AlA-AlA%AlA,.AlA4.AlA<.AlA)AlA)AlA%AlA)AlA%AlA)AlA3AlA3AlAT.AlA\.AlAd.AlAl.AlAt.AlA|.AlA.AlA(?AxBDXAxB.AlA.AlA)AlA)AlA3AlA.AlA"AlA*AlA/AlA3AlA/AlA/AlA /AlA(/AlA0/AlA,*AlA8/AlA@/AlAH/AlAP/AlA4*AlA<*AlAX/AlA`/AlAh/AlAhA/AAlA3A3A A B3A3A4A B 4A4 B@AlA@AlA@AlA@AlA@AlA4Ad B4A B4A B4A BAAlAAAlAAAlAAAlA AAlA(AAlA5A B 5AD B(5A BA B05A BHA85AP5AT5At5A Bx5A|5A5A5A5A5A5A5A5A5A 6A6A06A B86A B@6AD BH6Ah BP6A BX6A B`6A Bh6ABp6At6A6A6A6A6A6A6A6A<B6A`B6A6A7AB$7Ap!B,7A!B47A BAA<7A!BH7A|BP7ABT7ABA(BA\B0AAA`7Ah7A7AB7AB7AB7AB7A8B7AhB7AB7AB7AB4AAlAAB>AA$>A AtA,B,>APB0>A4>A@>AH>Ah>Ap>A>AtB>AB>AB>A B>ADB)AlA>AB>AB>AB>A$B>ATB>AB>AB>AB>AB?A@B ?AtB?AB?AB ?AB(?A,?AD?AHBL?AtBT?AB\?Ad"B`?ABd?A$Bl?Ap?A?A?A?A?A?A?A?AXB?AB@AB@AB@A @A(@A,@AL@A BT@AH B\@Ap BkAd@A|@A B@A@A@A B@A B@A!B@A@!BhA@AAlAHXAxBPXA0yBXXAhyB`XAyBhXAyBpXAzBxXADzBXAzBXAzBXAzBXA4{BXA`{BAAlAAAlAAAlAXA{BXA{BXA{BXA(|BXA\|BXA|BXA|BXA|BXA,}BXA`}BXA}BYA}BAAlAAAlAAAlAYA}BYA,~BYA\~B YA~B(YA~B0YA~B8YAB@YALBHYA|BPYABXYAB`YABXBAlA`BAlAhBAlAhYAHBpYAtBxYABYÀBYABYA0BYAdBYABYAYABAlABAlABAlABAlABAlABAlAYAYAYAYAZAZA ZAB(ZA؁B0ZAB8ZA B@ZAPBHZABPZAȂBXZAB4AAlA??0@p>?@Y@?@@{Gz?$@0@p>?0@p>p@??pA?pAXbXb?`C`Circ_msg.catLANGFORMALRETURNGLOBAL I32 %lx != %lx SI32 %ld != %ld F32 %f != %f I64 %lx:%lx != %lx:%lx SI64 %ld:%ld != %ld:%ld F64 %f != %fBad second argumentsegment_size = 0x%x = %dInput file: %s corruptedroutine_name = '%s'file_name = '%s'prof_dir = '%s'NTDLL module not foundSignal %s is raisedSignal %s is raised at 0x%pSIGSEGVSIGILLSIGBUSSIGFPEunknownNo errorFatal Error: This program was not built to run on the processor in your system.Run-Time Check Failure: The variable '%s' is being used without being initialized Windows XP 64-bit Edition Version 2003 or newer should be used.Intel(R) Core(TM) Duo processors and compatible Intel processors with supplemental Streaming SIMD Extensions 3 (SSSE3) instruction supportIntel(R) Pentium(R) 4 and compatible Intel processors with Intel(R) Streaming SIMD Extensions 3 (Intel(R) SSE3) instruction supportIntel(R) Pentium(R) 4 and compatible Intel processors. Enables new optimizations in addition to Intel processor-specific optimizationsIntel(R) processors with SSE4.2 and POPCNT instructions supportPlease verify that both the operating system and the processor support Intel(R) AVX.Please verify that both the operating system and the processor support Intel(R) AVX, F16C and RDRAND instructions.Please verify that both the operating system and the processor support Intel(R) AVX2, BMI, LZCNT and FMA instructions.Constant propagation error (%s substitution):Fatal Error: Can not initiate the HeapUsage: %s input_file output_fileUsage: %s segment_size input_file [-trace]Conversion from text file %s to binary %s completedCannot allocate memory to hold segment (size = 0x%x)Dynamic profile created from file %s completedThe allowed processors are: %s.Error: Buffer overrun occurred, forced exitInitialization of symbol handler failed. Error code %dRtlCaptureContext function not found in ntdll.dllStackWalk is terminated abnormally. Error code %dException is raised during stack walkingYou must link with libunwind to use traceback functionalityIntel(R) Pentium(R) M and compatible Intel processorsIntel(R) processors with Swing New Instructions supportIntel(R) processors with MOVBE instructions supportFatal Error: This program was not built to run in your system.;_`8 @0Є (`@0 `P h x`Ph@` hXx`0Ph@0@H`@0(08P X x    8 X xP   0 8 Xx@H` @``P@@ p( H ph    0 `X!x" "x @0K  8  " 8  "8  "8  "8  "L!  8  " 8  " 8  "8  "8  "D<Z@` GP[@@[@0\@P@SM @]@p (08@]80( @$c@0%     D k@ (0880( 80( 80( g)<r@ (08V80( '80( T,p@2   ό /0 ƃ/02I TP@ (0*( 0( 0( 0J( 0( 0@  (00(  ̌ &̌ v ̴ @  (00(  ̌ &̌ v L @ld p@l :  @@ 0C"aS-O t @ 0C"aS-O 4 @ (08`80( `80( `]80( `L @d @@` (08P{80( P 80( P80( |@P  #@p@U *@&ό`@   \`@ (0  TE0(   \@QLd@   D b    0@ j v zRx P.# <`TlP 0.# d@ { x,p.# Ljl.# p@`.# p `$8.# DHp\`t.# `@.# d w TtH.# dX t .# d< t 8.# 0 .# d<0 t h.# 0PD9 d< t d t d  { t(D9 00jH$D9 dD t d t d H { |  D9  0 (0 @j , PD 8 \ @0t X `0 a     ((  ( ( ( < $T Q_@X? @ H@`@@@@ v f @8 @ o @oo@(f @ @ @ @ @. @> @N @^ @n @~ @ @ @ @ @ @ @ @ @@@.@>@N@^@n@~@@@@@?@@ @0@@@P@`@p@AxA<@AAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA?@ ;Zx0Nm`@@@EEEEEEEE E E $E E 0ETEE8EETEpEEEE@EEE